KEGG   Oceanithermus profundus: Ocepr_1805Help
Entry
Ocepr_1805        CDS       T01369                                 

Definition
(GenBank) homodimeric glycerol 3-phosphate dehydrogenase (quinone)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
opr  Oceanithermus profundus
Pathway
opr00564  Glycerophospholipid metabolism
opr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:opr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ocepr_1805
Enzymes [BR:opr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Ocepr_1805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA Lycopene_cycl HI0933_like 3HCDH_N Pyr_redox NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ADR37257
UniProt: E4U9U3
LinkDB All DBs
Position
1818751..1820361
Genome map
AA seq 536 aa AA seqDB search
MNREKQLDALKNRTFDLLVIGGGATGAGIALDAATRGLSVALVERGDFSEGTSSRSTKLV
HGGVRYLEAAVKHLDRVQYNLVRDALRERGIILRLAPHLAHPIPLLTPLYRAWEVPYYFS
GLKAYDLLAGHERLKPSRFVPRSRALEEFPQLKEEGLVGGVEYYDGQFDDARMNVAVILT
ALREGATVANYVEVTGLVKQGDRVAGAEVRDRLADEDFTVRARTVVNATGPFTDLIRRMD
DPDAPPMVVTSSGVHIVLPGRFSPPGTGLLIPKTEDGRVLFVLPWMGHTLAGTTDEPAEL
SFHPRPQEEEIDYILRHLKRYFALEPGRDDILAAWSGLRPLVRDPKAHDTAELARDHIIS
ESDSGLVTIAGGKWTTYRKMAEDLVDYVVRTRDLHPARGCITDRVFVEGAAGFDADGWRG
LVERFGLDEDVARHLNQSYGDRAPEVARLAAEGFGERLAQEHPFVEAEVVWAVRREMAVT
PIDALARRTRLAFLDQKAALAALKRTADLMAAELGWSVEEQQAHVDEARTRLLEAL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgggaaaagcagctcgacgcactgaagaaccggaccttcgacctgctcgtcatc
ggcggcggcgccaccggggcgggcatcgcgctggacgccgccacccgggggctgagcgtg
gcgctggtggagcgcggcgacttctccgagggcacctcgagccgaagcaccaaactcgtc
cacggaggggtgcgctacctcgaggccgcggtcaagcacctcgaccgggtccagtacaac
ctggtgcgcgacgccctgcgcgaacgcggcatcatcctgcgcctcgcgccccacctggcc
caccccattcccctgttgacgccgctctaccgggcctgggaggtgccctactacttctcg
ggcctcaaagcctacgacctgctcgcagggcacgaacgcctcaagcccagccgcttcgtc
ccccgcagccgggcgctcgaggagttcccccagctcaaggaggaggggctcgtcggcggg
gtggagtactacgacggccagttcgacgacgcgcggatgaacgtggcggtgatcctgacc
gcgctgcgcgaaggggcgacggtcgccaactacgtcgaggtgacgggcctcgtcaagcag
ggggaccgggtcgccggcgccgaggtgcgcgaccgcctggcggacgaggacttcacggtg
cgcgcccgcaccgtggtcaacgccaccggccccttcaccgacctgatccgccgcatggac
gaccccgacgcccccccgatggtggtcaccagctccggggtgcacatcgtcctgcccggc
cggttcagccccccgggcacgggcctgctcatccccaagaccgaggacgggcgcgtcctc
ttcgtgctcccctggatggggcacaccctggccgggaccaccgacgaacccgccgagctc
agcttccacccgcgcccgcaggaggaggagatcgactacatcctgcggcacctgaagcgc
tacttcgcgctcgagcccggacgggacgacatcctcgccgcctggagcgggctgcggccg
ctggtgcgggaccccaaggcgcacgacaccgccgaactcgcccgcgaccacatcatcagc
gagtcggacagcggcctggtcacgatcgccggcggcaagtggacgacctaccgcaagatg
gccgaggacctggtggactacgtggtgcgcacccgcgacctgcacccggcgcgcggctgc
atcaccgaccgggtcttcgtcgagggggccgccggtttcgacgcggacggctggcgcggc
ctggtcgagcgcttcggcctcgacgaggacgtggcccggcacctgaaccaaagctacggc
gaccgcgcgcccgaggtggcccgcctcgccgccgagggcttcggcgaacggctggcgcag
gagcaccccttcgtcgaggccgaggtcgtctgggcggtgcggcgggagatggccgtcacc
cccatcgacgcgctcgcgcgccgcacccggctggccttcctggaccagaaggcggccctc
gcggcgctcaagcgcaccgccgacctgatggcggccgagctgggctggagcgtggaagag
caacaggcgcacgtggacgaggcgcggacccgcctgctcgaagcgctctga

DBGET integrated database retrieval system