KEGG   Ochrobactrum pseudogrignonense: A8A54_00745Help
Entry
A8A54_00745       CDS       T04415                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ops  Ochrobactrum pseudogrignonense
Pathway
ops00564  Glycerophospholipid metabolism
ops01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ops00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A8A54_00745
Enzymes [BR:ops01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A8A54_00745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ANG95140
UniProt: A0A1A9FH82
LinkDB All DBs
Position
1:160908..162419
Genome map
AA seq 503 aa AA seqDB search
MAQHKIFDIFVIGGGINGCGIARDAVGRGFSVGLAEMNDLASGTSSRATKLIHGGLRYLE
HYEFRLVREALMEREVLWANAPHLIHPMRFVLPFHKGGVRPAWLLRLGLFLYDHLGGRKK
LPATRTLDMRTDPSSAPLKPLFTKAFEYSDCWVDDARFTALTARDAADRGAMIRTRTKVV
SARRDHEAWTVTLENVDTGLREEFRSRLLVNAAGPWADKVLEGVEGDRQLHNVRLVQGSH
IVVRKKFSDPRSYFFQNNDGRIIFAIPYEDDFTLIGTTDQDYKGDPAKVAISDKETDYLC
AAASEYFREPVRIEDIVWTYSGVRPLYDDGASKAQEATRDYVLKEDAPQGAAPLINVFGG
KLTTARRLAEHMLEKIEHHLGKKGAPWTHAASLPGGDFEATAFDRELEKLKADYPFLPHL
HARRLFKLYGTRARILLGKSKSLEELGRHLGSDLYEVEVRYLMEHEWAHTAEDILWRRTK
LGLRMNAIEVSSLETFVQPAKVA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcataaaatttttgatattttcgtaatcggtggcggcatcaatggatgcggc
attgcaagagacgcggttggtcgtggcttttcggtcggtcttgccgagatgaacgatctg
gcaagcggcacctcgtcgcgtgccactaagcttatacatggcggattacgctatctggag
cattacgaatttcgcctggtgcgcgaagcgctgatggaacgcgaggtactttgggctaat
gccccgcatctgattcatccgatgcgctttgtgcttccctttcacaaaggtggcgtgcgc
cctgcctggttactgcgccttggcctgttcctttatgaccatctcggtggccgcaagaaa
ctgccagccacgcgcacgcttgatatgcgtaccgatccctcgagcgcaccgctcaagcca
ctttttacaaaggctttcgagtattcggattgctgggtggacgatgcgcgctttactgcg
ctgacggcgcgcgatgctgctgatcgtggcgcgatgatccgcacccgcaccaaggttgtt
tctgctcgccgtgaccatgaagcatggacggtaacgctcgaaaacgtcgatacaggtctg
cgcgaagagtttcgctcgcgtctcctggtcaatgcagccggcccatgggctgataaggtg
ctggaaggtgtcgaaggcgatcgtcagttgcataatgtgcgtctggtgcaaggcagccat
atcgtggtgcgcaaaaagttctccgatccgcgctcctatttcttccagaacaatgacggg
cgcatcatcttcgctattccttacgaagatgattttacgctgattggcaccaccgaccag
gattataaaggtgatcccgccaaggttgcgatcagcgacaaggaaaccgattatctctgc
gctgcggcaagcgaatatttccgcgagccggtgcggattgaagatattgtctggacctat
tccggcgtgcgtccgctctatgatgacggtgcaagcaaggcgcaggaagcaacccgcgat
tatgtgctcaaagaagatgcgccgcagggagctgcaccgctcatcaatgtgtttggtggt
aagctgaccaccgcgcgcaggctggccgagcatatgcttgagaagatcgagcatcatctt
ggcaagaaaggtgctccttggacccatgccgcgtctctgccaggtggtgattttgaggca
acggcttttgaccgggaactggaaaagctgaaagctgattatccgttcttgccacacctc
catgcccgtcgcctgtttaagctctatggaacacgcgcacgtattttgctgggtaaatcc
aagtctttggaagagcttggacgacatttgggcagcgatctttatgaggtggaagtgcgc
tatcttatggagcatgaatgggcacatacggcagaagatattctctggcgccgcaccaag
ctcggcctgcgcatgaatgcgattgaagtctcttcgcttgagactttcgtccaacctgcc
aaagtcgcgtaa

DBGET integrated database retrieval system