KEGG   Ochrobactrum pseudogrignonense: A8A54_00755Help
Entry
A8A54_00755       CDS       T04415                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
ops  Ochrobactrum pseudogrignonense
Pathway
ops00010  Glycolysis / Gluconeogenesis
ops00620  Pyruvate metabolism
ops01100  Metabolic pathways
ops01110  Biosynthesis of secondary metabolites
ops01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ops00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A8A54_00755
   00620 Pyruvate metabolism
    A8A54_00755
Enzymes [BR:ops01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     A8A54_00755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ANG95142
UniProt: A0A1A9FIN4
LinkDB All DBs
Position
1:163689..165206
Genome map
AA seq 505 aa AA seqDB search
MNKVEFHRSVKPEFAKRYGNFIGGKWVEPKSGRYFDNTSPVNGQVLCEVARSDAADVDAA
LDAAHAAKEAWGKTSPAERAVILNKIADRIEENLPKLAAAETWDNGKPIRETTHADLPLA
IDHFRYFAGAIRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPLLMAVWKLAPALAA
GNCVVLKPAEQTPASILVLMEVIGDLLPAGVINVVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFSDVTAEDDDFFDKAIEGFVMFALNQGEVC
TCPSRALVHEKIYDKFMERALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYIDIGKQ
EGAEVLTGGGRNELAGDLAGGYYVKPTVFKGTNKMRIFQEEIFGPVVSVTTFKDDAEALS
IANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRENH
LKMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagttgaatttcatcgctccgtaaagccggagtttgccaaacgttatggcaat
ttcattggcggcaaatgggttgaacccaagtcgggccgctatttcgacaacacatcgccg
gtcaacggtcaggtgctttgcgaagtcgcgcgttccgatgcggctgatgtcgatgcagca
cttgatgcagcccatgcagcgaaagaagcatggggcaaaaccagcccggcagaacgcgct
gtgatcctcaacaagatcgcagaccgcattgaagaaaacctgccaaagcttgctgctgct
gaaacatgggacaatggcaagccgatccgcgaaacaactcatgccgatctgccgctggca
atcgaccatttccgctactttgcgggtgcaatccgcgcgcaggaaggtggcatttccgaa
atcgatcacgacacggttgcctatcacttccacgaaccgctcggcgttgttggccagatc
atcccttggaacttcccgctgctgatggctgtgtggaagctggcaccagcacttgccgct
ggtaactgcgtggtgctgaagcctgcagaacagacacctgcttccattcttgttctgatg
gaagtgattggcgatcttttgccagcaggcgtcatcaacgtggtcaatggctttggtctt
gaagcaggcaagccgctggcatcgagcccgcgcattgccaagatcgcctttaccggtgaa
acgacgacgggtcgtctcatcatgcaatatgccagccagaaccttattccagtcacgctg
gaactgggcggcaagtcgccaaatatcttcttctccgatgtgacggccgaagatgacgat
ttcttcgacaaggctatcgaaggcttcgtcatgtttgcgcttaatcagggcgaagtctgt
acctgcccgagccgtgcactggtccatgaaaagatctacgacaagttcatggaacgcgca
ttgaagcgcgttgaggctatcgttcagggcgatccgcttgatccggcaaccatgatcggt
gcgcaggcatccagcgagcagctcgaaaaaattctgagctatatcgatatcggcaagcag
gaaggcgcggaagtgctgacgggcggtgggcgcaatgagctggccggcgatctggcaggc
ggctattacgtcaagccgactgtgttcaagggcaccaacaagatgcggattttccaggag
gaaatcttcggtcctgttgtttcggttacgacgtttaaggacgatgccgaagcgctctcg
attgccaatgacacgctttatggtctgggtgccggtgtgtggacgcgtgacggcacgcgc
gcctatcgcttcggtcgcgccattcaggccggtcgtgtctggaccaattgctaccacgcc
tatccggcccatgcggcgttcggtggctataagcagtcgggtatcggtcgtgaaaaccac
ctcaagatgctcgaccattaccagcagaccaagaacatgctggtgagctacagcccgaag
aagctcggcttcttctaa

DBGET integrated database retrieval system