KEGG   Ochrobactrum pseudogrignonense: A8A54_01240Help
Entry
A8A54_01240       CDS       T04415                                 

Definition
(GenBank) Hsp33 family molecular chaperone
  KO
K04083  molecular chaperone Hsp33
Organism
ops  Ochrobactrum pseudogrignonense
Brite
KEGG Orthology (KO) [BR:ops00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ops03110]
    A8A54_01240
Chaperones and folding catalysts [BR:ops03110]
 Heat shock proteins
  HSP33
   A8A54_01240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: ANG95229
UniProt: A0A1A9FHM5
LinkDB All DBs
Position
1:272350..273372
Genome map
AA seq 340 aa AA seqDB search
MADKTSIEHNEEEVVQIDLNNFDFAGDDAVVPFQVEGLDVRGRAVQLGASIDAILKRHNY
PETVARLLAEATVLTVLLGTSLKFEGKFIFQTQSDGPVDMLVVDFRTPRSVRAYARFDAE
RVAEAVSAGKTRPEELLGRGTLAFTVDQGSHTQRYQGIVALDGSTLEEIARTYFRQSEQI
ATDMKLSVAKLVERGSDGKLVERWRAGGLMIQFLPESEIRSRMPDLPGGDGDENTVVLDL
EDDGWDEARSLVGTIESSELTDPQVGSERLLYRLFHERGVRIYEAIRVVDDCACSREKIE
GVFSNFSAEEIQDSVEDGKISVTCEFCSKTYEFDPAQFAK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ttggctgacaagaccagcattgagcataacgaagaagaagtcgttcagatcgacctgaat
aacttcgacttcgcaggcgacgacgccgttgtgcccttccaggtggaagggctcgacgtg
cgcggtcgcgccgttcagttgggtgcaagcatcgacgctattctcaagcgtcacaattat
ccggaaacagtcgcacgcctgctggcagaagccactgtactcacggttctgcttggcacg
tctctgaaattcgaaggcaagttcatcttccagacccagtccgacggacctgtcgatatg
ctggtcgtggatttccgtacaccacgttcggtgcgtgcctacgcacgttttgatgccgaa
cgcgtcgcggaagcggtgagcgcaggcaagacacgtccggaagaactgcttggccgtggc
acgcttgcttttacggttgaccagggttcccacacgcagcgctatcagggcattgtggct
ctcgatggatcgacgctggaagagatcgcacgcacctacttccgccagtcggagcagatt
gcaaccgatatgaagctaagcgttgcaaagctcgttgagcgcggcagcgacggcaagctg
gtcgaacgttggcgcgccggtggcttgatgatccagttcctgccggaatccgaaattcgg
tcacgcatgccggaccttccgggtggcgatggcgacgaaaacacagttgttctcgacctt
gaagacgacggctgggatgaagcgcgctcgctggttggcacgattgaaagctcggaactg
accgacccacaggttggctcggagcgtctgctttatcgtctgttccatgagcgtggcgtt
cgcatctatgaggcgatccgggttgtcgatgattgcgcctgttcgcgcgagaagatcgaa
ggtgtcttttcaaacttctcggctgaagaaattcaggatagcgtcgaggatggcaagatt
tcggttacgtgcgaattctgctccaaaacctatgagtttgatcctgcacagtttgcgaaa
taa

DBGET integrated database retrieval system