KEGG   Ochrobactrum pseudogrignonense: A8A54_02460Help
Entry
A8A54_02460       CDS       T04415                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ops  Ochrobactrum pseudogrignonense
Brite
Enzymes [BR:ops01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A8A54_02460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ANG95454
UniProt: A0A1A9FJH0
LinkDB All DBs
Position
1:517452..518048
Genome map
AA seq 198 aa AA seqDB search
MAFELPALPYDYDALAPFMSRETLEFHHDKHHQAYVTNGNKLLEGSGLEGKSLEEIVKES
FGKNQALFNNAGQHYNHLHFWNWMKKDGGGKKLPGKLEKAVESDLGGYDKFREDFIAAGA
GQFGSGWAWLSVKNGKLEISKTANGESPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLVNWDYVLELYEKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgaactgcccgcccttccgtacgattatgacgcacttgctccgttcatgtcg
cgcgaaaccctcgaattccaccacgacaagcaccatcaggcttatgttaccaatggtaac
aagctgctcgaaggttccggccttgaaggcaaaagcctcgaagaaatcgtcaaggaaagc
ttcggcaagaatcaggcgctcttcaacaatgctggtcagcactacaaccatctccatttc
tggaactggatgaagaaagacggcggcggcaagaagctgccaggcaagcttgaaaaggct
gttgaatccgatctcggcggctacgacaagttccgcgaagacttcatcgctgctggcgct
ggtcagttcggttcgggctgggcatggctgtcggttaagaacggcaagctcgaaatctcg
aagaccgcaaacggtgaaagcccgctggttcacggcgcaacgccaatcctcggcgtcgac
gtatgggaacattcctactacatcgattaccgcaacgcgcgtccgaagtacctcgaagct
ttcgttgatagccttgttaactgggattacgtcctggagctttacgaaaaggcataa

DBGET integrated database retrieval system