KEGG   Ochrobactrum pseudogrignonense: A8A54_05245Help
Entry
A8A54_05245       CDS       T04415                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ops  Ochrobactrum pseudogrignonense
Pathway
ops00010  Glycolysis / Gluconeogenesis
ops00020  Citrate cycle (TCA cycle)
ops00620  Pyruvate metabolism
ops01100  Metabolic pathways
ops01110  Biosynthesis of secondary metabolites
ops01120  Microbial metabolism in diverse environments
ops01130  Biosynthesis of antibiotics
ops01200  Carbon metabolism
Module
ops_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ops00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A8A54_05245
   00020 Citrate cycle (TCA cycle)
    A8A54_05245
   00620 Pyruvate metabolism
    A8A54_05245
Enzymes [BR:ops01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A8A54_05245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N DUF2118 HlyD_2
Motif
Other DBs
NCBI-ProteinID: ANG95943
UniProt: A0A1A9FLK5
LinkDB All DBs
Position
1:complement(1097876..1099216)
Genome map
AA seq 446 aa AA seqDB search
MPIKITMPALSPTMEEGNLSKWLVKEGDKVTSGDVIAEIETDKATMEVEAVDEGVVAKLV
VPAGTEGVKVNALIAILAEDGEDVAEAAKGGDSAPAPKAEAAKEEPKKEVATAAPAKAEA
PAAAPAAAKSAENKGDRVFASPLARRIAKDAGVDVSAVKGTGPHGRVVQRDVEAAIKSGG
AKAASAAPQAAASAPKPQSDDAILKLFEEGTYEIVPHDGMRKTIARRLVESKQTVPHFYL
TIDCELDALLALRSQINSAAPLTKTEKGEVPAYKLSVNDLVIKAVALALRDIPEANVSWT
EGGMIKHKRADVGVAVSIPGGLITPIVRQSESKTLSAISNEMKDLAKRARDRKLKPDEYQ
GGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEQRAVVKNGEIKVATVMSVTLSTDHR
AVDGALAAELAQAFKRHIENPMGMLV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaatcaccatgccagcactttcgccaaccatggaagagggcaatctctcc
aagtggctggtcaaagaaggcgacaaggttacgtccggcgatgtgattgctgagatcgaa
accgacaaggcgacgatggaagtcgaagctgtcgatgaaggtgttgttgccaagcttgtc
gttcctgctggaaccgaaggcgtcaaggttaacgcgctgatcgcaatcctcgccgaagac
ggcgaggatgttgcagaagcagccaaaggcggcgattccgctcctgcaccaaaggcagaa
gcagctaaggaagagccaaagaaggaagttgcaaccgcggctcctgcaaaggctgaagcc
ccagcagctgctccggcagcagccaagagtgccgagaacaagggcgaccgcgttttcgca
tcgccgcttgctcgtcgcatcgccaaggatgcaggcgttgatgtctccgctgtaaaaggc
actggccctcatggccgtgtcgttcagcgtgacgttgaagctgcaatcaagtccggcgga
gcgaaagcagcatccgctgcgccacaggcagctgcatcggctccaaagcctcagtcggat
gatgccatcctcaagctctttgaagaaggcacatacgaaatcgttcctcacgacggtatg
cgcaagaccattgcccgccgtctggttgaatcgaagcagactgttccgcatttctatctg
acgatcgattgcgaactcgatgcgcttctggctttgcgttcgcagatcaattcggctgca
ccactgaccaagacggagaagggtgaggttccggcctacaagctttctgtcaacgatctg
gtgatcaaggctgttgctcttgcgctgcgtgacattcctgaagccaacgtctcctggact
gaaggcggcatgatcaagcacaagcgtgcggatgtcggcgttgctgtgtcgatccctggc
ggtctgattacgccaatcgtgcgtcagtcggaatccaaaacgctgtccgccatctccaac
gagatgaaggaccttgccaagcgtgcgcgtgatcgcaagctcaagcctgatgaatatcag
ggtggttcgacctctgtgtccaacctcggcatgttcggcgtgaaggactttgcagcaatc
atcaacccaccacatgcgacgatcttcgcaatcggtgcgggcgaacagcgcgcagtggtc
aagaacggtgaaatcaaggttgcgacggttatgtccgtgaccctttccaccgatcaccgt
gccgtcgatggtgctctggccgctgaacttgcacaggccttcaagcgtcacatcgaaaac
ccgatgggtatgctggtctaa

DBGET integrated database retrieval system