KEGG   Ochrobactrum pseudogrignonense: A8A54_05300Help
Entry
A8A54_05300       CDS       T04415                                 

Definition
(GenBank) preprotein translocase subunit SecG
  KO
K03075  preprotein translocase subunit SecG
Organism
ops  Ochrobactrum pseudogrignonense
Pathway
ops02024  Quorum sensing
ops03060  Protein export
ops03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ops00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    A8A54_05300
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A8A54_05300
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A8A54_05300
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ops02044]
    A8A54_05300
Secretion system [BR:ops02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   A8A54_05300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecG
Motif
Other DBs
NCBI-ProteinID: ANG95954
UniProt: A0A1A9FL10
LinkDB All DBs
Position
1:complement(1109743..1110192)
Genome map
AA seq 149 aa AA seqDB search
MQTIVIVIHLLIVLALVGVVLIQRSEGGGLGIGGGSGFMTARGAANALTRTTAILAIGFF
ATSLVLGIMARYGEKPTDILNRIPAAGSTQNPPAGGTGTGTGGGILNQLGGESSRTNEAE
TPASGEAPATAPAQPDSTQPQAPQVPSSQ
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccatagtcattgtcattcatttgttgatcgttctggcgcttgttggcgttgtg
ctcatccagcgttccgaaggcggtggccttggtatcggcggtggttcgggcttcatgacg
gcacgcggcgcggctaacgcgctgacccgcacgacagctattcttgcgattggcttcttc
gccacttcgctcgttctcggcatcatggcccgttatggcgaaaagccaacggacattctg
aaccgtattcctgcagctggcagcacgcagaatcctcctgctggtggaactggtaccggt
actggcggtggcattctcaatcagctgggtggtgagtcttcgcgcaccaatgaagctgaa
acacctgcttcgggtgaagctccagcaactgcaccagcgcagcctgacagcactcagcca
caggctccacaggttccaagctcacaataa

DBGET integrated database retrieval system