KEGG   Ochrobactrum pseudogrignonense: A8A54_05585Help
Entry
A8A54_05585       CDS       T04415                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ops  Ochrobactrum pseudogrignonense
Pathway
ops00020  Citrate cycle (TCA cycle)
ops00480  Glutathione metabolism
ops01100  Metabolic pathways
ops01110  Biosynthesis of secondary metabolites
ops01120  Microbial metabolism in diverse environments
ops01130  Biosynthesis of antibiotics
ops01200  Carbon metabolism
ops01210  2-Oxocarboxylic acid metabolism
ops01230  Biosynthesis of amino acids
Module
ops_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ops_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ops00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A8A54_05585
  Metabolism of other amino acids
   00480 Glutathione metabolism
    A8A54_05585
Enzymes [BR:ops01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A8A54_05585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ANG96009
UniProt: A0A1A9FJS4
LinkDB All DBs
Position
1:1168086..1169300
Genome map
AA seq 404 aa AA seqDB search
MAKIKVANPVVELDGDEMTRIIWQFIKDKLIHPYLDIDLKYYDLSVEHRDATNDQVTIDA
ANAIKEHGVGVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGVIFREPIICKNVPRL
VPGWTQPIIVGRHAFGDQYRATDFKFPGKGTLSIKFVGEDGETIEHEVYQAPAAGVAMAM
YNLDESIREFARASLNYGLQRNYPVYLSTKNTILKAYDGRFKDIFEEVYQAEFAEKFKEA
KIWYEHRLIDDMVASALKWSGGYVWACKNYDGDVQSDIVAQGFGSLGLMTSVLMTPDGKT
VEAEAAHGTVTRHYRQHQKGEETSTNSIASIFAWTRGLAHRAKLDNNAELKRFADTLEKV
CVDTVESGYMTKDLALLIGPDQPWLSTTGFLDKIDENLQKAMAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatcaaggttgcaaacccggtcgttgaactcgacggcgatgagatgacccgc
atcatctggcagttcatcaaggacaagctgatccatccatacctcgacatcgatctgaaa
tattacgatctgtcggtcgagcaccgtgatgctaccaatgaccaggttaccattgatgct
gcaaacgccatcaaggaacacggcgttggcgtcaagtgcgcaaccatcacgccggacgaa
gcccgtgttgaagaattcaagctcaagaagatgtggaagtcgcctaacggcaccatccgt
aacatcctcggcggcgttatcttccgcgagccaatcatctgcaagaacgttcctcgcctg
gttccaggctggacccagccaatcatcgttggccgtcacgcttttggtgaccagtaccgc
gcgaccgatttcaagttccctggcaagggcacgctgtcgattaagttcgtcggtgaagac
ggcgaaaccatcgagcacgaagtctatcaggctccggctgctggcgtggcaatggccatg
tacaatctcgacgaatcgatccgcgaatttgcacgcgcttcgctgaactacggcctgcag
cgcaattatccggtctatctctcgaccaagaacaccattctgaaggcctatgacggccgc
ttcaaggacattttcgaagaagtctatcaggctgaattcgctgagaaattcaaggaagca
aagatctggtacgaacatcgcctgatcgacgatatggttgcttcggccctcaagtggtcg
ggcggttatgtctgggcttgtaagaactacgacggcgacgttcagtccgacatcgtggca
cagggcttcggctcgctcggtctgatgacctcagttctgatgacgccagatggcaagacc
gttgaagcggaagctgcacacggcaccgtgacccgtcactatcgccagcatcagaagggc
gaagaaacttcgaccaactcgattgcttcgatcttcgcatggacccgcggcctcgcacat
cgtgcaaagctcgacaacaatgctgagctgaagcgctttgccgacacgttggaaaaggtc
tgcgtcgatacagtcgaaagcggttacatgaccaaggatctggcgctgctcatcggtcca
gatcagccttggctctcgaccactggcttcctcgacaagatcgacgaaaaccttcagaag
gcaatggctgcttaa

DBGET integrated database retrieval system