KEGG   Ochrobactrum pseudogrignonense: A8A54_06670Help
Entry
A8A54_06670       CDS       T04415                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ops  Ochrobactrum pseudogrignonense
Pathway
ops00473  D-Alanine metabolism
ops00550  Peptidoglycan biosynthesis
ops01100  Metabolic pathways
ops01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ops00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A8A54_06670
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A8A54_06670
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    A8A54_06670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ops01011]
    A8A54_06670
Enzymes [BR:ops01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A8A54_06670
Peptidoglycan biosynthesis and degradation proteins [BR:ops01011]
 Precursor biosynthesis
  Amino acid ligase
   A8A54_06670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: ANG96205
UniProt: A0A1A9FLW8
LinkDB All DBs
Position
1:complement(1385166..1386104)
Genome map
AA seq 312 aa AA seqDB search
MAGQKAGKHVAVLMGGLSSERPVSLSSGTACAQTLEECGYRVTRIDVGRDVASVLAELKP
DVAFNALHGPFGEDGTIQGILEYLQIPYTHSGVLASALAMDKDRAKTVASAAGVAVAPSL
LLNRFEIGSEHPMKPPYVVKPVREGSSFGVVIVKEDQTHPPQIISSAEWNYGAEVLVEKY
IAGRELTCAVMGDRAMDVCEIIPVGHQFYDYDSKYVAGASTHVCPAKILPNIYQKIQTMA
LTAHRAIGCRGVSRSDFRFDDRFSEEGEVIWLEVNTQPGMTPTSLVPDIAKAAGISFGEL
LSWMVEDASCLR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggctggacagaaggctggaaagcatgttgccgttttgatgggtggcttgtcatcggag
cgtccagttagtctctcgtccggaactgcctgtgcgcaaacccttgaagagtgcggctat
cgcgtgacgcgcattgatgttggtcgcgatgtcgcgagtgttcttgctgagctgaagcct
gatgttgcgttcaatgcgctgcacggcccgttcggcgaagatggtacgatccaaggcatt
ctcgaatatcttcaaataccttacacgcattccggtgtgctggcttcagcgctcgctatg
gataaggatcgtgccaagactgttgcatctgctgcaggtgtagctgttgcgccgtcgctt
ctgctcaaccgtttcgaaatcggttctgagcatccgatgaagccgccttacgtcgtcaag
ccggtccgtgaaggttcgagcttcggtgttgtaatcgtcaaggaagatcagactcacccg
ccgcaaatcatcagctctgctgaatggaattatggtgccgaggttctggtcgaaaaatac
atcgctggccgcgaattgacctgcgccgtgatgggtgatcgcgcgatggacgtctgcgag
atcattccagtggggcatcagttctacgattatgattcaaaatatgttgcaggcgcatca
actcacgtgtgtccggcaaaaattttaccaaatatttaccaaaaaatacaaacaatggcc
cttacggcgcatcgggcaatcgggtgtcggggcgtaagcagatcagacttccgtttcgac
gatcgtttttccgaagaaggcgaagttatttggctggaagttaacacccagccgggaatg
actcctacctcgctcgtacctgatatcgcgaaggcggcaggtatctcttttggtgaattg
ttgagttggatggtggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system