KEGG   Ochrobactrum pseudogrignonense: A8A54_07715Help
Entry
A8A54_07715       CDS       T04415                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ops  Ochrobactrum pseudogrignonense
Pathway
ops00473  D-Alanine metabolism
ops01100  Metabolic pathways
ops01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ops00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A8A54_07715
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    A8A54_07715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ops01011]
    A8A54_07715
Enzymes [BR:ops01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A8A54_07715
Peptidoglycan biosynthesis and degradation proteins [BR:ops01011]
 Precursor biosynthesis
  Racemase
   A8A54_07715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Yop-YscD_ppl
Motif
Other DBs
NCBI-ProteinID: ANG96388
UniProt: A0A1A9FKZ7
LinkDB All DBs
Position
1:1615753..1616904
Genome map
AA seq 383 aa AA seqDB search
MTDMSMHFSQTERDLAAGGVLTIDLKALRHNYSTIAKRIAPTRTAAVVKADSYGLGANRV
APAFYEAGCRDFFVAHLGEAITLRPFLNPDATLYVLNGLQPGTEAVCAREKILPVLNSLE
QIENWSALAASLNEKLPALLQIDTGMSRLGLSAKELDQLVDDQHLLDHIDVKFVISHLAS
GDEPENPANARQLAAMNAALARLPKMPVAFSNSGGCFLDNTYHFNLARPGVALYGVGPET
GENPMKPVLELSARVIQVRDIDKGAAVGYGGTFVASKPMRIATIAVGYADGWFRALSNKG
SAFYGDTRLPIVGRVSMDSITLDVTALPEGAIKLGSLVELVGPHQRLEDVARDCDTIPYE
ILTSLGHRYARVYVDGAASETKA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatgtcgatgcatttttctcaaactgaacgagacctcgccgcaggcggcgtt
ctaaccatcgaccttaaagccctgcgccacaattattcgaccatcgcaaagcgcattgcg
ccaacccgcacagccgctgttgtgaaagctgattcttacggtcttggtgcaaaccgcgtc
gcgccggctttttatgaagcaggttgccgcgatttcttcgtcgcccatcttggcgaagca
attacgctccgcccttttctcaatccagatgcgacgctttacgtgctgaacggccttcag
cccggtacggaagctgtctgcgcacgcgagaaaatcctgcctgttctcaactcgctggag
cagattgaaaactggtcggcacttgccgcaagcctgaacgaaaaactgcctgcgctgctg
cagatcgataccggcatgtcgcgccttggcctgtcggccaaagaactcgaccaactggtc
gatgaccagcatcttctggaccatatcgacgtcaaatttgtcatcagccatctggcgagc
ggcgatgagccggaaaacccggccaatgcccgtcagcttgccgccatgaatgcagcgctc
gcacgtttgccaaaaatgccggtggcattttcaaattccggcggctgctttctcgataac
acataccacttcaatctcgcacgcccgggcgtggccctttatggcgtcggccctgaaacg
ggcgaaaatcctatgaagccggtccttgagctatcagcgcgcgtcattcaggtgcgcgat
atcgataagggtgcggcagtcggttatggcggcacattcgtagcaagcaagcccatgcgg
attgcaaccatcgcagtcggttatgccgatggctggttccgcgctttgagcaacaagggc
tccgccttttatggtgatacgcgcctgccgattgtcggtcgtgtttcgatggattcgatc
acgcttgacgtaacggctctgccggaaggcgcaatcaagcttggcagtctggttgaactc
gtcggcccgcatcagcgactcgaagatgtggcccgcgattgcgacaccattccttatgaa
atcctgacttcattaggccaccgctatgcccgtgtttacgtggatggcgcagcatctgaa
acaaaagcataa

DBGET integrated database retrieval system