KEGG   Ochrobactrum pseudogrignonense: A8A54_16145Help
Entry
A8A54_16145       CDS       T04415                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
ops  Ochrobactrum pseudogrignonense
Brite
KEGG Orthology (KO) [BR:ops00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A8A54_16145
Enzymes [BR:ops01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     A8A54_16145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 Methyltransf_11 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ANG97876
UniProt: A0A1A9FQJ3
LinkDB All DBs
Position
1:complement(3463784..3464815)
Genome map
AA seq 343 aa AA seqDB search
MKTVVIHAAKDLRLEERDVEAVGSGQLEVTIQAGGICGSDLHYYNHGGIGAIRLREPMIL
GHEVAGTITALGSGVVGLTVGDQVAVSPSRPCNACQYCLKGMQNHCLNMSFYGSAMPTPH
IQGAFRQKLVAESWQCHKVDNGISIHEAAFAEPLAVTLHAVTRAGSLLNKRVLVTGCGPI
GALIIIAARAHGAREVIATDVMEPVLKKAREIGADRTINVAEDPEQLANYAANKGYFDIM
FEASGNERAMRAGLEVLKPLGILVQVGLGGDVSIPQNIVVSKEIDMRGSFRFHEEFGLAV
DMINRKAVDVKPLLSSVYPLEDVLAAFEIAGDRNQSMKVQLAF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgttgtcattcacgccgccaaagaccttcggcttgaagagcgtgacgtcgaa
gccgtcgggtcgggccagcttgaggttaccattcaagcgggtggtatttgtggctccgat
ctccattattataatcatggcggtatcggtgccattcggctgcgtgagccaatgatattg
gggcatgaagtcgcgggaacaatcactgcgctgggcagtggtgtggttggtttgacagtt
ggtgatcaggtagctgtatcgccaagcaggccctgcaatgcttgccaatattgcctgaaa
ggtatgcagaaccactgcctgaatatgagcttttatggtagtgctatgccgacgccccac
attcagggggcgtttcgccagaagctggttgctgagagctggcagtgccacaaggttgat
aacggcatctctatccatgaggcggcatttgccgaaccattagccgttacacttcatgct
gtgacacgcgccggttcactgctgaacaagcgtgtgcttgtgacaggatgtgggccaatt
ggtgcattaatcatcattgccgctcgtgcccacggcgctcgcgaagtgattgcaacagat
gtcatggagccagttttgaaaaaggcacgcgaaattggggccgatcgcaccatcaatgta
gcggaagatccagagcagttagcaaactatgcggcgaataaaggctatttcgacattatg
tttgaggcatcgggcaatgaacgtgccatgcgggcaggacttgaagtgctaaaacctctt
ggcattttggtacaagtcgggcttggcggcgatgtatcgattccgcaaaatatcgtcgtc
tccaaagaaattgatatgcgtggttctttccgctttcacgaagagttcggcctcgcggtt
gatatgattaatcggaaggctgtcgatgtgaagccgcttttgagttcagtttatccgttg
gaagatgttcttgcggcatttgaaattgcgggtgacaggaaccaatccatgaaagttcaa
ctggctttttag

DBGET integrated database retrieval system