KEGG   Ornithobacterium rhinotracheale ORT-UMN 88: Q785_04230Help
Entry
Q785_04230        CDS       T03303                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ori  Ornithobacterium rhinotracheale ORT-UMN 88
Pathway
ori00240  Pyrimidine metabolism
ori01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ori00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Q785_04230
Enzymes [BR:ori01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Q785_04230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK ATPase_2
Motif
Other DBs
NCBI-ProteinID: AIP99095
LinkDB All DBs
Position
complement(849138..849728)
Genome map
AA seq 196 aa AA seqDB search
MFLENTINHRKNTGWIEVICGSMFSGKTEELIRRVKRAELAGQKVEIFKPAIDKRYDEQD
VVSHDENKKQATPIEASSNLPILASDCDVVGIDEAQFFDEGIVEVANLLANSGKRIIIAG
LDMDFKGRPFGPMPNLMAVAEYVTKVHAICVKTGNLANYSHRKIKSDKLVELGERAEYEP
LSRAVFWEELRKEEEK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagagaataccataaatcatagaaaaaatacgggctggatcgaagtaatctgt
ggctctatgttttcgggcaaaaccgaagagttgattcgtagagtgaaacgagccgaattg
gctgggcaaaaggtagaaatctttaaacccgcaattgataaacgctacgatgagcaagat
gtggtatcgcatgatgaaaacaaaaaacaagcaaccccgattgaggcgagttctaacttg
cccattttagcaagcgattgtgatgtggtggggatagatgaggctcaattctttgacgaa
ggaattgttgaggtggcaaatcttttagctaattcggggaaaagaataattattgcggga
ttagacatggattttaaaggtcgtccatttggtcctatgccaaatttaatggcggtagcg
gaatatgtgaccaaagtgcatgcaatctgtgtgaaaacagggaatctagccaattattct
catcgaaaaattaagagtgataaattggtggagcttggcgaaagagcagaatacgaacct
ttgagccgagcagtcttctgggaagaattaagaaaggaagaagaaaaataa

DBGET integrated database retrieval system