KEGG   Ornithobacterium rhinotracheale ORT-UMN 88: Q785_10300Help
Entry
Q785_10300        CDS       T03303                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ori  Ornithobacterium rhinotracheale ORT-UMN 88
Pathway
ori00473  D-Alanine metabolism
ori00550  Peptidoglycan biosynthesis
ori01100  Metabolic pathways
ori01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ori00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Q785_10300
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Q785_10300
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Q785_10300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ori01011]
    Q785_10300
Enzymes [BR:ori01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Q785_10300
Peptidoglycan biosynthesis and degradation proteins [BR:ori01011]
 Precursor biosynthesis
  Amino acid ligase
   Q785_10300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 ATP-grasp GARS_A
Motif
Other DBs
NCBI-ProteinID: AIP99959
LinkDB All DBs
Position
2081116..2082093
Genome map
AA seq 325 aa AA seqDB search
MQNVAIVMGGYSGEYEVSLKSGQTIFDHIDTSKYKPTKVLIGTDGWFAQVGDKKFLIDKA
DFSFKNEKGEKTSFNVVFNIIHGTPGEDGQMQAYWQLINLPYVGCGHYLSALTFSKKDCI
AVLSKYGISSAKSVYLVKGDKYDLDEIIEKIGLPCFVKPNQSGSSLGVSKVKTKEEFEPA
LEKAFKEDHDILIESFLDGTEVSVGVVQYNGETIVSGITEIVSENEFFDYNAKYEGASQE
ITPARLSPEITQKVEQIAKKAYESLRMKGMSRSEYIIVNGEPNFIEMNTLPGFSPASILP
QQLAYSKIEIKDFITSEIESALAQK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgttgccatcgtgatgggcgggtactctggcgagtacgaagtttcgctaaaa
agcggacaaacgatttttgatcatatagacacttctaaatataagccaaccaaagtttta
atcggtacagatgggtggtttgcacaagtaggggataagaaattcctgattgataaagcg
gatttttcttttaagaatgaaaaaggagaaaaaacaagtttcaatgtagtatttaacatc
attcacggaacgccaggcgaagatggacaaatgcaagcctattggcaactaattaatttg
ccatatgtgggctgtgggcattatctttcggcacttacttttagtaaaaaagactgcatc
gcagtactgagcaaatatggtatttcttcggctaaatcggtatatttagtgaaaggagat
aaatatgatttagatgagattattgaaaaaatcgggttgccatgctttgtgaaacccaac
caatcaggttcaagtttaggcgtttctaaagtgaaaaccaaagaagaatttgaacccgct
ctagaaaaagcatttaaggaagatcatgatattttgattgaatctttcctcgacggaacc
gaggtatctgtgggggtggtgcaatataatggagaaaccattgtgagcggaataacagaa
attgtatcagaaaacgaattttttgattacaatgctaaatatgaaggcgcttcgcaggaa
attacaccagctagattgtcgccagaaatcacccaaaaagtagagcaaattgctaaaaaa
gcctatgaatcgttgcgtatgaagggcatgtctcgtagcgaatacattatcgtaaatgga
gagcctaattttatagaaatgaacactttgccaggcttttcgccagcgagtattttgcca
caacaattggcttattccaaaatagaaatcaaagattttatcacaagtgaaatcgagagc
gctctggctcaaaaataa

DBGET integrated database retrieval system