KEGG   Oricola sp. MEBiC13590: HTY61_01360
Entry
HTY61_01360       CDS       T06643                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
orm  Oricola sp. MEBiC13590
Pathway
orm00473  D-Alanine metabolism
orm00550  Peptidoglycan biosynthesis
orm01100  Metabolic pathways
orm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:orm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HTY61_01360
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HTY61_01360
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    HTY61_01360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:orm01011]
    HTY61_01360
Enzymes [BR:orm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HTY61_01360
Peptidoglycan biosynthesis and degradation proteins [BR:orm01011]
 Precursor biosynthesis
  Amino acid ligase
   HTY61_01360
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N GARS_A ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST Ntox30
Other DBs
NCBI-ProteinID: QKV17207
UniProt: A0A6N1VDT6
LinkDB
Position
299359..300294
AA seq 311 aa
MADRARKHVVVLMGGFSSERPVSLMSGNACADELERCGYRVTRLDVGHDVAQKLAEIRPD
VAFNALHGPFGEDGTIQGILEYMEIPYTHSGVLASAITMNKDMAKRVAKSHGIPVAESKT
MNRHDFTSSHPMRPPYVVKPVSEGSSFGVVIVKEDQPHPPQVITSDEWKYGDTVMVERYV
HGRELTCAVMGNVALGVTEIIPQGHQFYDYDSKYAEGGSNHVCPAEISPNIYQTITKLAL
KAHQAFGCRGVTRSDFRYDDRFSPNGEVIWLEINTQPGMTATSLVPELALYAGHSFGELL
SWMVEDASCLR
NT seq 936 nt   +upstreamnt  +downstreamnt
atggccgatcgcgcgcgaaaacatgtcgtggttcttatgggcggcttttcgtccgaacgg
cccgtgagcctgatgtcgggcaatgcatgtgccgacgagctcgagcgttgcggttacagg
gttacgcgcctcgatgtcggacacgacgtggcgcagaagctggccgagatcaggccggac
gtcgcgttcaatgcgctgcacggtccgttcggcgaggacgggacgatccagggaatcctc
gaatacatggaaattccctacacccattcgggcgttctggcctccgcgatcacgatgaac
aaggacatggccaagcgggtggcgaagagccatggaattcccgtggccgagtcgaagacg
atgaaccggcacgatttcacctcgagccatccgatgcggccgccatacgtcgtcaagccg
gtgtcggaaggctccagcttcggcgtcgtgatcgtcaaggaggaccagccgcatccgccg
caagtcatcacttccgacgagtggaagtacggcgataccgtgatggtcgagcgctatgtt
cacggccgcgaactgacctgtgccgtgatgggcaatgtggcgcttggcgtgaccgagatc
attccgcaggggcaccagttctacgactacgattcgaaatacgcggaaggcggatcaaat
cacgtctgtccggcggaaatttcaccaaatatttaccaaacaataaccaagctggcgctc
aaagctcatcaggcgtttgggtgccggggcgtgacgcgttcggacttccgctacgatgat
cgcttttccccgaatggggaggtgatctggttggaaatcaacacccagcccgggatgacg
gcgacatcgcttgttcccgaactggccttgtatgccgggcattccttcggcgagctcttg
agttggatggtggaggacgcatcttgtttgcgttga

DBGET integrated database retrieval system