KEGG   Ornithinimicrobium sp. AMA3305: DV701_06835Help
Entry
DV701_06835       CDS       T05559                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
orn  Ornithinimicrobium sp. AMA3305
Pathway
orn00620  Pyruvate metabolism
orn00680  Methane metabolism
orn01100  Metabolic pathways
orn01120  Microbial metabolism in diverse environments
orn01200  Carbon metabolism
Module
orn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:orn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DV701_06835
  09102 Energy metabolism
   00680 Methane metabolism
    DV701_06835
Enzymes [BR:orn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DV701_06835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AXH95881
UniProt: A0A345NLH3
LinkDB All DBs
Position
complement(1514564..1517371)
Genome map
AA seq 935 aa AA seqDB search
MNEPDATHPPADAGQQAPAPHDPISPELRADVRRLSTLLGQALVRHHGQELLDTVEQVRL
TTKASQEGDDAAAEQVRQVLAGLPLDTASSLVRAFSAYFHLANAAEQVHRVRTLTSRPES
EGWLTAAVRDVVAAGGPELLASTVEELDVRPVFTAHPTEASRRSVLTKIRHLSDLLAVGT
EPDTVARRRQDHDLAELIDLIWQTDELRQSRPTPMDEARNAMYYLEEVLGTTVPELLGEL
GDLLAEHGVDVDPTRPPVRFGSWIGGDRDGNPFVTPEVTREVLQLHGRHAVGVAVSLVDV
LISRLSSSTDVVQVDPRLEESVRLDLEHLPGLDPRVLELNAHEPYRLKLTCVRAKLLNTG
RRLEQGTPHEPGRDYADVQDILADLEVVAQSLRSHGGGLVADGGLARATQTLAGTGLHLA
TLDVREHAEKHHEAIAPLLDAAGATGPEGYAVLDGPARTGLLAEELGSRRPLLTRAAARS
QTLAVFDEIREALDTYGDEAIETYVISMTQGPDDVLAAAVLAREAGLVDLHGSTGENGAF
ARIGFAPLLETIDELAGAAELVGTLLSTPSYRELVRLRGDVQEVMLGYSDSNKQAGVLTS
QWGIHQAQRALRDVAAEHGVRLRLFHGRGGSVGRGGGPTYEAILAQPNGVLEGEIKFTEQ
GEVISDKYSLPALAKENLELSVAAVLRASALHRDPRTTAAERERFGEVMELASDAAFTAY
RRLIEDPDLPAYFVAATPVDQLGALNIGSRPSKRPDTGKGLEGLRAIPWVFGWTQTRQIV
PGWYGVGSGLRAAREAGHGDTLKEMLERWHFFAAVVSNVEMTVVKTDLGIAAHYVGSLVP
PELRHVFDDIRAELELTVAELRLLTGEEELLDDQPVLQRTLAVRDNYLDPISYLQVELLR
RLREEDGADAATTAQLQRALLATVNGVAAGLRNTG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgagcccgacgcgacacaccccccggccgacgccggccagcaggccccggcaccg
cacgacccgatcagccccgagctgcgcgcggacgtccggcgcctgtcgaccctgctcggc
caggccctggtgcgccaccacggccaggagctgctcgacacggtcgagcaggtgcggctg
acgaccaaggccagccaggagggtgacgacgccgccgccgagcaggtgcgccaggtgctc
gccgggctcccgctggacaccgcctcctccctcgtccgggccttctccgcctacttccac
ctggccaacgccgccgagcaggtccaccgggtgcggacgctgacctcgcgccccgagtcc
gaggggtggctcaccgcggccgtccgcgacgtcgtcgccgccggcgggccggagctgctg
gccagcacggtcgaggagctcgacgtgcgccccgtcttcaccgcgcaccccaccgaggcc
tcccgccgcagcgtgctgaccaagatccggcacctgtccgacctgctcgcggtcggcacc
gagcccgacaccgtcgcgcgccgccgccaggaccacgacctggccgagctcatcgacctc
atctggcagaccgacgagctgcggcagagccggcccacgccgatggacgaggcccgcaac
gccatgtactacctcgaggaggtcctcggcacgaccgtgccggagctgctgggcgagctg
ggcgacctgctggccgagcacggcgtcgacgtcgacccgacgcgcccgccggtccgcttc
ggctcctggatcggcggcgaccgggacggcaacccgttcgtcacccccgaggtcacccgc
gaggtcctccagctccacgggcggcacgcggtcggcgtggcggtctcgctcgtcgacgtg
ctcatctcccggctgtcctcctccaccgacgtggtgcaggtggacccacggctggaggag
tcggtgcgcctcgacctggagcacctgccgggcctggacccgcgcgtgctcgagctcaac
gcccacgagccctaccggctcaagctgacctgcgtgcgcgccaagctgctcaacaccggc
cgccggctcgagcagggcaccccccacgagccgggccgcgactacgccgacgtccaggac
atcctcgccgacctcgaggtcgtcgcccagtccctgcggagccacggcggcgggctcgtc
gccgacggcggcctggcgcgcgccacccagacgctcgccggcaccgggctgcacctggcc
accctcgacgtgcgcgagcacgccgagaagcaccacgaggcgatcgcccccctcctggac
gccgccggcgcgaccgggcccgaggggtatgccgtgctggacggcccggcgcgcaccggc
ctgctcgccgaggagctgggctcgcgccgccccctgctcacccgtgccgccgcccgctcg
cagacactcgcggtcttcgacgagatccgggaggcgctggacacctacggcgacgaggcg
atcgagacctacgtcatctcgatgacccagggaccggacgacgtgctcgccgcggcggtg
ctcgcccgagaggcgggcctggtggacctgcacggcagcacgggggagaacggcgccttc
gcccggatcggtttcgcgcccctgctggagacgatcgacgagctggccggcgccgccgag
ctggtcggcacgctgctgtccaccccgtcctaccgcgagctggtgcggctgcgcggcgac
gtgcaggaggtcatgctcggctactccgactccaacaagcaggccggcgtgctcaccagc
cagtggggcatccaccaggcgcagcgcgcgctgcgcgacgtcgccgccgagcacggcgtg
cggctgcggctcttccacggccggggcggctccgtgggtcgcgggggcggcccgacctac
gaggcgatcctggcccagcccaacggggtgctcgagggcgagatcaagttcaccgagcag
ggtgaggtcatctccgacaagtactccctgcccgcgctggccaaggagaacctcgagctc
tccgtcgcggccgtcctgcgcgcctccgccctgcaccgcgacccgcggaccaccgcggcc
gagcgcgagcgcttcggcgaggtcatggagctcgcctcggacgcggcgttcacggcatac
cgccggctcatcgaggacccggacctgccggcctacttcgtggccgccaccccggtggac
cagctcggtgcgctcaacatcggctcccgccccagcaagcggccggacaccggcaagggt
ctggaggggctgcgcgcgatcccgtgggtcttcggctggacccagacgcggcagatcgtc
ccgggctggtacggcgtgggctctggcctgcgcgccgcccgcgaggccggccacggcgac
accctcaaggagatgctcgagcgctggcacttcttcgccgcggtggtctccaacgtggag
atgaccgtggtcaagaccgacctcggcatcgccgcgcactacgtcgggtccctggtgccg
ccggagctgcggcacgtcttcgacgacatccgcgccgagctggagctgaccgtcgccgag
ctgcggctgctcaccggcgaggaggagctgctcgacgaccagcccgtcctgcagcgcacc
ctggcggtgcgggacaactacctggacccgatctcctacctgcaggtggagctcctgcgg
cggttgcgcgaggaggacggcgcggacgcggccaccaccgcccagctgcagagggcgctg
ctggcgaccgtgaacggggtggctgccgggctgcgcaacacggggtga

DBGET integrated database retrieval system