KEGG   Ornithinimicrobium sp. AMA3305: DV701_10165Help
Entry
DV701_10165       CDS       T05559                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
orn  Ornithinimicrobium sp. AMA3305
Pathway
orn03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:orn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    DV701_10165
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:orn03400]
    DV701_10165
Enzymes [BR:orn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DV701_10165
DNA repair and recombination proteins [BR:orn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     DV701_10165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N
Motif
Other DBs
NCBI-ProteinID: AXH96435
UniProt: A0A345NN27
LinkDB All DBs
Position
2214248..2215885
Genome map
AA seq 545 aa AA seqDB search
MAGGRHTSRDGGRENAAPLETYRLMRDFGRTPEPSGGALLEAARQDGERVFVVQRHRATA
RHYDFRLEVDGVLASWAVPKGPSLDPETRRLAIHVEDHPMEYLHFEGVIPAGEYGGGDVI
VWDTGTWDSHDEDAAAAIRAGTLHVRLHGEKLRGEFMLVRTARQEGRKEQWLLFHKHDEH
AVEGWDAEDHPRSVLSGRTNEEVAADPDALWHSDRPVGEAAEPLRAPVPPPATEEELRAL
EELGASGTWEVFGRALRLTNLDKVLFPGRQGEEPVTKRELVRYAALVAPVSLPYLAGRAL
NLHRYPNGAERKGFWHKEVPEHAPEWLPRWDNPAADPGETQTYLVVDEPAALVWAANFGA
LEWHPWTSPTEAPDRPSYVMFDIDPGERTTWDETLELAQLHRTAFEHLGVRACPKVTGRR
GLQVWVPIRRGPTFEETRRWAEKVSRSIGAVVPELVSWKWSVKERGGLARLDYTQNAVNK
TLVAPYSPRPSPGAPVSTPITWEELDDPHLRPDRWTVRTVLDRLAEKGDLFSGVLHHDQT
LPRVK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgggcggcatacctcgagggacggcgggcgggagaacgcggcgccgctggag
acctaccggctgatgcgcgacttcgggcgcacccccgagccgagcggcggcgcgctgctg
gaggctgcacgtcaggacggcgagcgggtcttcgtcgtgcaacggcaccgggcgacggcg
cggcactacgacttccggctcgaggtcgacggtgtcctggccagctgggcggtgcccaag
ggaccctcgctggacccggagaccagacggctcgcgatccacgtcgaggaccacccgatg
gagtacctccacttcgagggggtcatcccggcgggcgagtacggcggcggggacgtcatc
gtctgggacaccggcacctgggactcccacgacgaggacgccgccgcggcgatccgcgcg
gggaccctccacgtgcgcctgcacggggagaagctgcgcggcgagttcatgctcgtgcgc
accgcccggcaggaagggaggaaggagcagtggttgctcttccacaagcacgacgagcac
gcggtcgagggctgggacgccgaggaccacccgcgctcggtgctcagcggccgcaccaac
gaggaggtcgctgccgaccccgacgcgctgtggcactccgaccggccggtcggggaggcc
gcggagccgctgcgggccccggtcccaccgcctgcgaccgaggaggagctgcgcgccctg
gaggagctgggcgcctccggcacgtgggaggtcttcggccgtgcgctgaggctcacgaac
ctcgacaaggtcctcttccccggccgccagggcgaggagccggtcaccaagcgcgagctc
gtcaggtatgccgcgctcgtcgccccggtctcgctgccgtacctggccggacgggcgctc
aacctgcaccgctacccgaacggcgcggagaggaagggcttctggcacaaggaggtgccc
gagcacgcgccggagtggctgccgcgctgggacaaccccgcggccgaccccggggagacg
cagacctacctggtggtcgacgagccggcggccctggtgtgggcggcgaacttcggggcc
ctggagtggcacccgtggacctcgccgaccgaggcgccggaccggccgtcctacgtgatg
ttcgacatcgaccccggcgagcggacgacgtgggacgagacgctggagctggcccagctg
caccggaccgccttcgagcacctgggggtgcgggcctgtcccaaggtgaccgggcggcgc
ggcctccaggtctgggtgccgatccgtcgggggccgaccttcgaggagacgcggaggtgg
gccgagaaggtgtcgcgctcgatcggggcggtcgtgcccgagctggtcagctggaagtgg
tcggtgaaggagcgcggtggtctcgcgcggctggactacacgcagaacgcggtcaacaag
acgctcgtggcgccgtactcaccacgcccgtcgcccggcgcaccggtgtcgacgccgatc
acgtgggaggagctggacgacccgcacctgcggcccgaccggtggacggtgcgcacggtg
ctggaccggctggccgagaagggcgacctgttctccggcgtgctgcaccacgaccagacg
ctgccgcgcgtgaagtga

DBGET integrated database retrieval system