KEGG   Ornithinimicrobium sp. AMA3305: DV701_10735Help
Entry
DV701_10735       CDS       T05559                                 

Definition
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
orn  Ornithinimicrobium sp. AMA3305
Pathway
orn00250  Alanine, aspartate and glutamate metabolism
orn00410  beta-Alanine metabolism
orn00640  Propanoate metabolism
orn00650  Butanoate metabolism
orn01100  Metabolic pathways
orn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:orn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DV701_10735
   00650 Butanoate metabolism
    DV701_10735
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DV701_10735
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DV701_10735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:orn01007]
    DV701_10735
Enzymes [BR:orn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DV701_10735
Amino acid related enzymes [BR:orn01007]
 Aminotransferase (transaminase)
  Class III
   DV701_10735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Avian_gp85 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AXH96536
UniProt: A0A345NNC8
LinkDB All DBs
Position
complement(2352497..2353753)
Genome map
AA seq 418 aa AA seqDB search
MATSLSPLLKQATGVIAARGEGALIFDEDDRRFLDFTAGIGVTSTGHCHPRVVAAAQEQV
GRLIHAQYTTVMHRPLLRLVERMGEVLPAGLDRVFFANSGSEAVEAALRLVRQATGRPNV
VTFHGGFHGRTVAAASMTTSGTKFRSGFAPLMAGVHLAPFPSPTHYGWSEQEATRFALRE
LDYLLQTVSSPADTAAFVVEPVLGEGGYVPASTEFLAGLRERADRHGILLVLDEVQTGWG
RTGRFWGHEHFDGRPDVVVTAKGLASGFPLSAIAASEELMSRAWPGSQGGTYGANAVACA
AAVATLDVIQDEGLVENAAARGEQLRAGLEKVAADDDRITDVRGLGLMLGNEFRDHAGEP
DGATAGAVQQEAARRGLLLLTCGAWGQVVRFIPALVVDEALVDEAVGIWAETVESVAS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgtcgttgtccccgctgctcaagcaggccacgggggtgatcgccgcccgcggc
gagggtgccctgatcttcgacgaggacgaccgtaggttcctcgacttcaccgccggcatc
ggcgtcacgagcacggggcactgccacccccgcgtcgtcgctgcggcgcaggagcaggtc
ggccggctgatccacgcccagtacacgaccgtgatgcaccggccgctgctgaggctggtg
gaacggatgggggaggtgctccccgccggcctggaccgggtcttcttcgccaactccggc
tccgaggcggtggaggcggcgctgcgcctggtgcgccaggccaccggccggcccaacgtc
gtcaccttccacggcgggttccacggccgcaccgtcgccgccgcctcgatgaccacctcg
ggcaccaagttccgctccggtttcgccccgctcatggccggggtgcacctggcgccgttc
cccagtcccacccactacgggtggagcgagcaggaggcgacccggttcgcgctgcgcgag
ctggactacctcctgcagacggtgagctcgccggccgacacggccgccttcgtggtggag
ccggtgctcggcgagggcggctacgtgccggcgtcgacggagttcctcgccgggctgcgc
gagcgggccgaccgccacggcatcctcctggtgctggacgaggtgcagaccggctgggga
cggaccgggcgcttctggggccacgagcacttcgacggccggccggacgtcgtcgtcacc
gccaagggactggcctccggcttcccgctgtcggccatcgccgcctccgaggagctgatg
agcagggcctggccgggctcgcagggcgggacctacggtgccaacgccgtcgcctgcgcc
gcggcggtcgcgaccctggacgtcatccaggacgagggcctggtcgagaacgccgccgcg
cgcggcgagcagctgcgggccgggctggagaaggtcgcggccgacgacgaccggatcacc
gatgtgcgcgggctcggcctcatgctgggcaacgagttccgcgaccacgccggcgagccc
gacggggccaccgccggcgcggtccagcaggaggccgcgcgccgcgggctgctgctcctg
acctgcggcgcctgggggcaggtggtccggttcatccccgccctcgtcgtggacgaggcg
ctggtggacgaggccgtcggcatctgggccgagacggtggagtcggtcgcgtcctga

DBGET integrated database retrieval system