KEGG   Ornithinimicrobium sp. AMA3305: DV701_10885Help
Entry
DV701_10885       CDS       T05559                                 

Definition
(GenBank) extracellular solute-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
orn  Ornithinimicrobium sp. AMA3305
Pathway
orn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:orn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DV701_10885
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:orn02000]
    DV701_10885
Transporters [BR:orn02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    DV701_10885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_11 SBP_bac_8 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: AXH96559
UniProt: A0A345NNF1
LinkDB All DBs
Position
complement(2387144..2388172)
Genome map
AA seq 342 aa AA seqDB search
MTPTLSRRTLIAALLASPVVLSACSGDEKYVPDPEALQIYSSQHQNVTEAWARAFTDATG
IKTQVRSGTDSSMGHMIVQEGDASPADVFLTENSPAMTVVERAGMLAPVEETTLEQVGEG
RAPSSGMWTGIAARSTVLVYNTSMITPAELPASMMDLQDAAWAGRWGCAPGGADFQAIVA
GMLVDRGEEETAAWLEGLKDGAEIYQNNIATMKAVNAGEVPVGIMYHYYWYRDQAGTKEG
SGNTELHYFGDQDPGAFVSLSAGGVLATTDKADEAQQFLAYLTSPEGQEVLVSSGSMEYP
VARGVPADPALPPLDSLDAPLVDPSALDSDKVVMMMTDAGIL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgacccccaccctgagccgccgcaccctgatcgccgcgctcctggccagccccgtcgtt
ctcagcgcgtgcagcggggacgagaagtacgtccccgaccccgaggcgctgcagatctac
tccagccagcaccagaacgtcaccgaggcatgggccagggcgttcaccgacgcgaccggg
atcaagacccaggtgcgctccggcacggactcctcgatggggcacatgatcgtccaggag
ggcgacgcctcgcccgccgacgtcttcctcaccgagaactccccggcgatgacggtcgtc
gagcgcgccggcatgctcgcgccggtcgaggagaccaccctggagcaggtcggcgagggc
cgggcgccctccagcggcatgtggaccggcatcgccgcgcgctccaccgtgctcgtctac
aacacctcgatgatcacgccggccgagctgcccgcctcgatgatggacctgcaggacgcg
gcctgggccgggaggtggggctgcgcccccggcggcgccgacttccaggcgatcgtcgcc
ggcatgctggtcgaccgcggcgaggaggagaccgccgcctggctcgaggggctcaaggac
ggcgccgagatctaccagaacaacatcgccacgatgaaggccgtcaacgccggcgaggtc
ccggtcgggatcatgtaccactactactggtaccgcgaccaggccggcaccaaggagggc
tcgggcaataccgagctccactacttcggcgaccaggacccgggtgccttcgtctcgctg
tccgcgggcggggtgctcgccaccaccgacaaggccgacgaggcccagcagttcctcgcc
tacctgaccagccccgagggccaggaggtcctggtcagcagcgggtcgatggagtacccc
gtcgcccggggggtgcccgccgaccccgccctgcccccgctggacagcctggacgcgccg
ctcgtggacccctcggcgctggactcggacaaggtcgtcatgatgatgacggatgccggc
atcctctga

DBGET integrated database retrieval system