KEGG   Ornithinimicrobium sp. AMA3305: DV701_15145Help
Entry
DV701_15145       CDS       T05559                                 

Definition
(GenBank) fumarate reductase/succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
orn  Ornithinimicrobium sp. AMA3305
Pathway
orn00020  Citrate cycle (TCA cycle)
orn00190  Oxidative phosphorylation
orn00650  Butanoate metabolism
orn01100  Metabolic pathways
orn01110  Biosynthesis of secondary metabolites
orn01120  Microbial metabolism in diverse environments
orn01130  Biosynthesis of antibiotics
orn01200  Carbon metabolism
Module
orn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
orn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:orn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DV701_15145
   00650 Butanoate metabolism
    DV701_15145
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DV701_15145
Enzymes [BR:orn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DV701_15145
    1.3.5.4  fumarate reductase (quinol)
     DV701_15145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 FAD_binding_3 NAD_binding_8 GIDA
Motif
Other DBs
NCBI-ProteinID: AXH97271
UniProt: A0A345NQG3
LinkDB All DBs
Position
3302688..3304658
Genome map
AA seq 656 aa AA seqDB search
MTDQLIDGLYREGEPIADTKAPDVPVPEMWTRRKFDAALVNPANRRKLDVIIVGTGLAGA
SAGATLGEAGYNVKSFCYQDSPRRAHSIAAQGGINAAKNYKDDGDSVYRLFYDTEKGGDY
RSRETNTYRLAEVSAGIIDQCVAQGVPFAREYGGLLDNRSFGGVQVSRTFYARGQTGQQL
LIGAYQALERQIAAGTVQMFARHEMLELVVVDGRARGIIARDLVSGEIETHMADAVVLAS
GGYGNVFYLSTNAMGSNVTAAWRAHRKGAYFANPCYTQIHPTCIPQSGEHQSKLTLMSES
LRNDGRIWVPKNAEDCDKDPRQIPPEDRDYYLERIYPAFGNLVPRDIASRQAKNMCDEGR
GVGPEVDGVRRGVYLDFAAAIERMGEEAVRAKYGNLFEMYEQITGDNPYQVPMRIYPAVH
YTMGGLWVDYDLEASIPGLFVAGEANFSDHGANRLGASALMQGLADGYFVLPNTIRAYLA
KGPFEKVAEDHPDVQDARRSVSDRVERFLSVGGTRSVDSYHKELGKIMWEKCGMERTDAG
LREAIEQVRALRQDFWDNVRVLGTADGLNQSLEKAGRVADFLEMGELMCIDALHRRESCG
GHFRAESQTEDGEALRHDDEFAYVAAWEWGGDGGTPVLHKEDLTFKAIELKQRSYK
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccagctgatcgacggcctctaccgcgagggcgagccgatcgccgacaccaag
gccccggacgtcccggtcccggagatgtggacccggcgcaagttcgacgcggccctggtc
aacccggccaaccggcgcaagctcgacgtgatcatcgtcgggaccggcctggccggcgcc
tcggcgggggcgaccctcggcgaggccggctacaacgtcaagtccttctgctaccaggac
agcccgcggcgcgcgcactcgatcgccgcccagggcgggatcaacgcggcgaagaactac
aaggacgacggcgactcggtctaccgcctcttctacgacaccgagaagggcggggactac
cgctcgcgggagaccaacacctaccggctggccgaggtgtccgcgggcatcatcgaccag
tgcgtggcccagggcgtgcccttcgcccgcgagtacggcggcctgctcgacaaccgctcc
ttcggcggcgtgcaggtctcccgcaccttctacgcgcgcggccagaccggccagcagctg
ctcatcggcgcctaccaggcgctggagcggcagatcgcggcgggcacggtccagatgttc
gcgcgccacgagatgctcgagctggtcgtcgtcgacgggcgggcccgcggcatcatcgcc
cgcgacctggtcagcggcgagatcgagacgcacatggccgacgcggtcgtgctggccagc
ggcggctacggcaacgtcttctacctgtcgaccaacgcgatgggctccaacgtcaccgcg
gcgtggcgggcgcaccgcaagggcgcctacttcgccaacccgtgctacacccagatccac
ccgacctgcatcccccagtccggggagcaccagtccaagctgacgctgatgagcgagtcg
ctgcgcaacgacggccgcatctgggtgccgaagaacgccgaggactgcgacaaggacccg
cggcagatcccgccggaggaccgcgactactacctggagcgcatctacccggccttcggc
aacctggtgccccgcgacatcgcctcgcgccaggccaagaacatgtgcgacgagggtcgc
ggcgtcggcccggaggtcgacggcgtccggcgcggcgtctacctggacttcgcggcggcg
atcgagcggatgggcgaggaggcggtccgcgccaagtacggcaacctcttcgagatgtac
gagcagatcaccggcgacaacccctaccaggtgccgatgcgcatctacccggccgtgcac
tacacgatgggcgggctgtgggtcgactacgacctcgaggcgagcatcccgggcctgttc
gtcgccggcgaggccaacttctccgaccacggcgccaaccggctgggggcctcggcgctg
atgcagggtctggccgacggttacttcgtgctgcccaacacgatccgcgcctacctggcc
aagggtcccttcgagaaggtcgcggaggaccaccccgacgtgcaggacgcgcgccgctcg
gtctcggaccgggtggagaggttcctgtccgtgggtggcacccgcagcgtcgactcctac
cacaaggagctcggcaagatcatgtgggagaagtgcgggatggagcgcaccgacgccggg
ctgcgcgaggccatcgagcaggtccgcgcgttgcgccaggacttctgggacaacgtgcgg
gtgctcggcaccgccgatggcctgaaccagtccctggagaaggccggccgggtggccgac
ttcctcgagatgggcgagctgatgtgcatcgacgccctgcaccggcgcgagtcctgcggc
ggccacttccgcgccgagtcccagaccgaggacggcgaggcgctgcggcacgacgacgag
ttcgcctacgtcgccgcctgggagtggggcggggacggcggcaccccggtcctgcacaag
gaagacctgaccttcaaggccatcgagctcaagcagaggagctacaagtga

DBGET integrated database retrieval system