KEGG   Ornithinimicrobium sp. AMA3305: DV701_15150Help
Entry
DV701_15150       CDS       T05559                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
orn  Ornithinimicrobium sp. AMA3305
Pathway
orn00020  Citrate cycle (TCA cycle)
orn00190  Oxidative phosphorylation
orn00650  Butanoate metabolism
orn01100  Metabolic pathways
orn01110  Biosynthesis of secondary metabolites
orn01120  Microbial metabolism in diverse environments
orn01130  Biosynthesis of antibiotics
orn01200  Carbon metabolism
Module
orn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
orn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:orn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DV701_15150
   00650 Butanoate metabolism
    DV701_15150
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DV701_15150
Enzymes [BR:orn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DV701_15150
    1.3.5.4  fumarate reductase (quinol)
     DV701_15150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_7 Fer4_10 Fer4_9 Fer4 Fer4_18 Fer4_4 Fer4_6 Fer2 Fer4_22 Fer4_2 Fer4_3 Fer4_16 Fer4_21 Fer4_15 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AXH97272
UniProt: A0A345NQG4
LinkDB All DBs
Position
3304655..3305398
Genome map
AA seq 247 aa AA seqDB search
MKLALSIWRQDGPRAKGRMVRYDIDGVSEDSSFLEMLDMLNEQLIEEGEEPVAFDSDCRE
GICGMCGVVVNGSAHGPERTTTCQLHMRSFKDGDEIVIEPWRADPFPVIKDLVVDRSAFD
RIIQAGGFVSVNTGAAPDAHAVPVPKEHADRAFMAAECIGCGACVAACPNGSASLFMGAK
ITHLGELPQGQPERDARAVAMTEQHDHEGFGGCTNLGECTRACPKGIPLNVISQMNGDVR
RAGYGHR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcgccctcagcatctggcggcaggacggtccccgagccaaggggcggatggtc
cgctacgacatcgacggggtctccgaggacagctcgttcctggagatgctcgacatgctc
aacgagcagctcatcgaggagggcgaggaaccggtcgccttcgactccgactgtcgcgag
ggcatctgcgggatgtgcggcgtcgtggtcaacggctcggcccacgggccggagcggacg
accacctgccagctgcacatgcgctccttcaaggacggcgacgagatcgtcatcgagccg
tggcgcgcggaccccttcccggtgatcaaggacctggtcgtcgaccgcagcgccttcgac
cggatcatccaggccggcggcttcgtctcggtcaacaccggtgccgcccccgacgcccac
gccgtgccggtccccaaggagcacgccgaccgggccttcatggcggccgagtgcatcggc
tgcggcgcctgcgtggcggcctgtcccaacgggtcggcctcgttgttcatgggtgccaag
atcacccatctgggcgagctgccgcagggccagccggagcgcgacgcgcgcgcggtggcg
atgaccgagcagcacgaccacgagggcttcggcggctgcaccaacctcggcgagtgcacc
cgcgcctgccccaagggcatcccgctcaacgtcatctcgcagatgaacggcgacgtccgc
cgcgccggctacgggcaccgctga

DBGET integrated database retrieval system