KEGG   Odobenus rosmarus divergens (Pacific walrus): 101362244
Entry
101362244         CDS       T05148                                 

Gene name
FYN
Definition
(RefSeq) tyrosine-protein kinase Fyn isoform X1
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04360  Axon guidance
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04520  Adherens junction
oro04611  Platelet activation
oro04650  Natural killer cell mediated cytotoxicity
oro04660  T cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04725  Cholinergic synapse
oro05020  Prion disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    101362244 (FYN)
   04071 Sphingolipid signaling pathway
    101362244 (FYN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101362244 (FYN)
   04520 Adherens junction
    101362244 (FYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101362244 (FYN)
   04650 Natural killer cell mediated cytotoxicity
    101362244 (FYN)
   04660 T cell receptor signaling pathway
    101362244 (FYN)
   04664 Fc epsilon RI signaling pathway
    101362244 (FYN)
  09156 Nervous system
   04725 Cholinergic synapse
    101362244 (FYN)
  09158 Development and regeneration
   04360 Axon guidance
    101362244 (FYN)
   04380 Osteoclast differentiation
    101362244 (FYN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    101362244 (FYN)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101362244 (FYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101362244 (FYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101362244 (FYN)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101362244 (FYN)
Protein kinases [BR:oro01001]
 Non-receptor tyrosine kinases
  SRC family
   101362244 (FYN)
Membrane trafficking [BR:oro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101362244 (FYN)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    101362244 (FYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3 zf-RING_14
Other DBs
NCBI-GeneID: 101362244
NCBI-ProteinID: XP_004406778
UniProt: A0A2U3WDX9
LinkDB
Position
Unknown
AA seq 537 aa
MGCVQCKDKEATKLTEERDGSLTQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcaacaaaactgacggaggagagggacggc
agcctgacccagagctccgggtaccgctatggcacagaccccaccccgcagcactacccc
agcttcggcgtgacctccatccccaactacaacaacttccacgcggccgggggccaagga
ctcaccgtctttgggggtgtgaactcttcatcacataccgggaccttgcgtaccagggga
ggaacgggagtgaccctgtttgtagccctttatgattatgaagcacggacagaagatgac
ctgagttttcacaaaggagagaaattccaaatattgaacagctcggaaggagattggtgg
gaagcccgctccttaacaaccggagagactggttacattcccagcaattatgtggctcca
gttgactctatccaggcagaagagtggtactttggaaaacttggccgaaaagatgctgag
cgacagcttttgtcctttggaaacccgagaggtacctttcttatccgtgaaagtgaaacc
accaaaggtgcctattcactgtcaatccgagattgggatgatatgaaaggagaccatgtc
aaacattataaaattcgcaaacttgacaatggtggatactatattaccacccgggcccag
tttgaaacacttcagcagcttgtacaacattactcagagagagccgcaggtctctgctgc
cgcctagtagttccctgtcataaagggatgccaaggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaatggaaacacaaaagtagccataaagact
cttaaaccaggcacaatgtccccggagtcattccttgaggaggcacagatcatgaagaag
ttgaaacacgacaagttggtccagctctacgcggtggtgtctgaggagcctatctacatt
gtcactgagtacatgaataaaggaagtctacttgatttcttaaaagatggggaaggaaga
gctctgaaattaccaaaccttgtggatatggcagcacaggttgctgcaggaatggcttac
atcgagcgcatgaattacatccacagggatctgcgatcagcaaacattctagtggggaat
ggactcatctgcaagattgctgactttggattggccagattgatcgaggacaacgagtac
acagcaaggcaaggtgcaaagttccccattaagtggacggctcccgaagcagccctgtat
gggaggttcacgatcaagtctgacgtgtggtcttttggaatcttactcacagagctggtc
accaaaggaagagtgccatacccaggcatgaacaaccgggaggtgctggagcaggtggag
cgcggctacaggatgccctgcccgcaggactgccccatctctctccacgagctcatgatc
cactgctggaagaaggacccggaagaacggcccactttcgagtacttgcagggcttcctg
gaagactacttcaccgccacagagccccagtaccagcccggtgaaaacctgtga

DBGET integrated database retrieval system