KEGG   Odobenus rosmarus divergens (Pacific walrus): 101362272
Entry
101362272         CDS       T05148                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform isoform X1
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00562  Inositol phosphate metabolism
oro01100  Metabolic pathways
oro04022  cGMP-PKG signaling pathway
oro04062  Chemokine signaling pathway
oro04072  Phospholipase D signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04371  Apelin signaling pathway
oro04611  Platelet activation
oro04725  Cholinergic synapse
oro04921  Oxytocin signaling pathway
oro05132  Salmonella infection
oro05145  Toxoplasmosis
oro05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101362272 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101362272 (PIK3CG)
   04072 Phospholipase D signaling pathway
    101362272 (PIK3CG)
   04022 cGMP-PKG signaling pathway
    101362272 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    101362272 (PIK3CG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101362272 (PIK3CG)
   04062 Chemokine signaling pathway
    101362272 (PIK3CG)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101362272 (PIK3CG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101362272 (PIK3CG)
  09156 Nervous system
   04725 Cholinergic synapse
    101362272 (PIK3CG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101362272 (PIK3CG)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101362272 (PIK3CG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101362272 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101362272 (PIK3CG)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101362272 (PIK3CG)
Membrane trafficking [BR:oro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101362272 (PIK3CG)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135 DUF3244 Myc-LZ
Other DBs
NCBI-GeneID: 101362272
NCBI-ProteinID: XP_004411977
UniProt: A0A2U3WRR0
LinkDB
Position
Unknown
AA seq 1121 aa
MQGDPEKRKSLEAHWVMSGMELKHHEQPVVLREDNGRRRRRMKPRSSAASLSSMELIPIE
FVLPTSQRNSKTPETALLHVAGHGNVEQMKAQVWLRALETSAAADFYHRLGPDHFLLLYQ
KKGQWYEIYDKHQVVQTLDCLRYWQVLHRSPGQIHVVQRRAPSEETLVFQRQLTALIGYD
VTDVSNVHDNELEFTRRRLVTPRMVEVAGRDPKLYAMHPWVTSKPLPEYLLKKITNNCIF
IIIHRSTTSQTIKVSADDTPGTILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYL
VGETPIKNFQWVRHCLKNGEEIHLVLDSPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTI
HGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNADLTVFVEANIQHGQQVLCQRRTSP
KPFTEEVLWNVWLEFSIKIKDLPRGALLNLQIYCSKAPALSGKASAETPGSESKGKAQLL
YYVNLLLIDHRFLLRHGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLD
NYCHPIALPKHRPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYE
SLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVR
AIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRS
EIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTIDIKSLSAEKYDVSS
QVISQLKQKLENLQNSNLPESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPT
ALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEI
VKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFV
LGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKK
TSLYFQKFQDVCVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNE
EEAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA
NT seq 3366 nt   +upstreamnt  +downstreamnt
atgcagggagacccagaaaagcggaagagtttagaggcacactgggtcatgtcgggcatg
gagctgaagcaccatgaacagcccgtggttctgagagaggacaacggccgccggcgccgg
aggatgaagccgcgcagctccgcagccagcctgtcctccatggagctcatccccatcgag
ttcgtgctgcccaccagccagcgcaacagcaagacccccgagacggcactgctccacgtg
gccggccacggcaacgtggagcagatgaaggcccaggtgtggctgcgcgcgctggagacg
agcgcggcggcggacttctaccaccggctcgggccggaccacttcctcctgctctaccag
aagaagggccagtggtacgagatctacgacaagcaccaggtggtgcagaccctggactgc
ctgcgctactggcaggtgctgcaccggagcccgggccagatccacgtggtgcagcggcgc
gcgccctccgaggagacgctggtcttccagcggcagctcaccgccctgatcggctacgac
gtcaccgacgtcagcaacgtgcacgacaacgagctcgagttcacgcgccgccgcctggtc
acgccgcgcatggtcgaggtggctggccgcgaccccaagctctacgccatgcacccgtgg
gtgacctccaagcccctcccggagtatctgctgaagaagatcaccaacaactgcatcttc
atcatcattcaccgcagcaccaccagccagaccatcaaggtctcggccgacgacacccca
ggcaccatcctccagagcttcttcaccaagatggccaagaagaagtctctgatggatatc
ccggagagccaaagcgaacaggattttgtgctgcgcgtctgcggccgggacgagtacctg
gtaggtgaaacgcccatcaaaaacttccagtgggtgaggcattgcctcaagaacggagag
gagattcacctggtgctggactcgcctccagacccagccctggacgaggtgaggaaagaa
gagtggccactggtggacgactgcacgggagtcactggctaccacgagcagctgaccatt
cacgggaaggaccacgagagtgtgttcaccgtgtccctgtgggactgcgaccggaagttc
agggtcaaaatcagaggcattgatatccctgtcctgccccggaacgccgacctcacggtt
tttgtggaggcaaacatccagcacgggcagcaggtcctttgccagaggagaaccagcccc
aaacccttcacggaggaggtgctctggaacgtatggcttgagttcagtatcaaaatcaaa
gacttacccagaggggctctactgaacctccagatctactgcagcaaagctccagcgctg
tctggcaaggcctctgcagagactcccggttccgagtccaaaggcaaagctcagcttctc
tattatgtgaacctgctgctgatagaccaccggttcctgctgcgccacggggagtatgtg
ctccacatgtggcagatttccggaaagggagaagaccaagggagcttcaatgcggacaag
ctcacgtcggcaaccaacccagacaaggagaactccatgtccatctccattcttctggac
aactactgtcacccaatcgccttgcctaagcatcggcccacccctgaccccgaaggggac
cgggttcgagcggaaatgcccaaccagcttcggaagcaactggaagcgatcatagccact
gatccacttaaccctctcactgcagaggacaaagaattgctctggcattttagatatgaa
agtcttaagcatccaaaggcctatccaaaactgtttagctctgtaaaatggggacagcaa
gaaattgtagccaaaacataccaactgttagccagacgggaggtctgggaccaaagtgct
ttggatgttgggttaacgatgcaactcctggactgcaacttttcggatgaaaacgtaaga
gccatcgcagttcagaaactggagagcttggaggacgacgatgtcctgcattacctgcta
cagctggtccaggctgtgaaatttgaaccatatcatgacagcgccctggcccgatttctg
ctgaagcgaggcttaagaaacaaaagaattggtcatttcttgttttggttcttgagaagc
gagatagcccagtccaggcactatcagcagaggttcgctgtgatcctggaagcctatctg
aggggctgcggcacggccatgctacacgacttcacccaacaagttcaagtgatcgagatg
ctgcagaaggtcaccattgatattaaatcgctctctgctgaaaagtatgatgtcagttcc
caagttatttcacaacttaagcaaaagctcgaaaacctgcagaattcgaatctcccagaa
agctttagagtgccgtatgaccctggactgaaggcaggagcattagcgattgaaaaatgt
aaagtgatggcctccaagaaaaagcccctgtggcttgagtttaaatgtgctgaccctaca
gccctatccaatgaaacgattggaatcatctttaaacatggtgatgatctgcgccaagac
atgctgattttacagattctacgaatcatggaatccatttgggagactgaatctttggat
ctgtgcctcctgccatatggttgcatttcaactggggacaaaataggcatgatcgagatc
gtgaaagatgccacgacaattgctaaaattcagcaaagcacagtgggcaacacgggtgca
ttcaaagatgaggtcctgaatcactggctcaaagaaaaatgccctatcgaagaaaagttt
caggcagctgtggagagatttgtttattcctgcgctggctactgtgtggctacctttgtt
cttggaataggcgacaggcacaatgacaatattatgatcacagagacaggaaacctattt
catattgactttggacacattcttgggaattacaaaagtttcctgggcattaataaagag
agagtgccgtttgtgctaaccccagacttcctgtttgtgatgggaacctctggaaagaag
acaagcctgtacttccagaaatttcaggacgtctgcgtcaaggcttacctagcccttcgt
caccacacaaacctgctgatcatcctgttctccatgatgctgatgacgggaatgccccag
ttaacaagcaaagaagatatcgaatatattcgggacgccctaacagtggggaagaatgag
gaggaagctaagaagtatttccttgatcagatcgaagtttgcagggacaaaggatggacg
gtgcagtttaactggttcctgcaccttgttctgggcatcaaacaaggagagaaacattca
gcctaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101374579
Entry
101374579         CDS       T05148                                 

Gene name
PIK3R5
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 5
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04022  cGMP-PKG signaling pathway
oro04062  Chemokine signaling pathway
oro04072  Phospholipase D signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04371  Apelin signaling pathway
oro04611  Platelet activation
oro04725  Cholinergic synapse
oro04921  Oxytocin signaling pathway
oro05145  Toxoplasmosis
oro05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101374579 (PIK3R5)
   04072 Phospholipase D signaling pathway
    101374579 (PIK3R5)
   04022 cGMP-PKG signaling pathway
    101374579 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    101374579 (PIK3R5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101374579 (PIK3R5)
   04062 Chemokine signaling pathway
    101374579 (PIK3R5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101374579 (PIK3R5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101374579 (PIK3R5)
  09156 Nervous system
   04725 Cholinergic synapse
    101374579 (PIK3R5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101374579 (PIK3R5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101374579 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101374579 (PIK3R5)
Membrane trafficking [BR:oro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101374579 (PIK3R5)
SSDB
Motif
Pfam: PI3K_1B_p101 ApoC-I
Other DBs
NCBI-GeneID: 101374579
NCBI-ProteinID: XP_004398499
UniProt: A0A2U3VTD3
LinkDB
Position
Unknown
AA seq 875 aa
MQPGATTCTEDRIQHALERCLHGLSLSRCSTSWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTREVQEKGTYDLLAPLALLFYSTVLCTPHFPPDSDLLLKAARTYHRFLTWPVPYC
SIYQELLTFIDAELKAPGITYQRLVRAEQGLPIRSHRSSTVTVLLLNPVEVQAEFLAVAN
KLSTPGHSPHSAYTTLLLHAFQATFGAHCDLPGLHGRLQSKSLAELEDIFTETAEAQELA
SGIGDAAEARQWLRTRLQAVGEKAGFPGVLDTAKPGQLRTIPIPVARCHTYSWNQDSFDI
LQEILLKEQELLQPGILGDDEEEEEEEEDLETDGLCAQRDSLLSTSSAVFHDSDLSLASS
QASGPALSRQLLTSFVSGLSDGVDSGYVEDSEESPTEWPKRPGGQERRGHRRPGQKFNRI
YKLFKSTSQLVLRRDSRGLEGGSVSGLPLRRAGSLCSPLDGPVPPPPPPPPARAQRSRSL
PQPKLSAQLPSWLLAPASRHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLR
QLENNHPLLTRFFKLQFFYVPVKRGQGTGSSACPAPASQTPPPPTDSPRHPSPAELESTN
DISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAESRPLDGSSAQLPILADMLLYYCRF
AARPVLLQVYQTELTFITGEKMKEIFIHSLELGHSAATRAIRASGPGSKRLGIDGDREAI
PLTLQIIYSKGAISGRSRWSNMEKVCTSVNLSKACQKQEELDSSMEALTLNLTEVVKRQN
PKSKKGFNQISTSQIKVDKVQIIGSNGCPFAVCLDQDERKILQSVVRCEVSPCYKPEKSS
LHPQPQRSLDPPTQAPPDLCSLLCLPIMTFSGALP
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgcagccaggggccacgacgtgcacggaggaccgcatccagcatgccctggagcgctgc
ctacacgggctcagcctcagccgctgctccacctcctggtcagctggcctgtgtctcaac
tgctggagcctacaggagctggtcagcagggacccgggccacttcctcatcctcctggag
cagatcctgcagaaaacccgagaggtccaagagaagggcacctatgaccttctcgccccc
ctggccctgctcttctactccactgtcctctgcacgccacacttcccacccgattcagat
ctccttctgaaagcagccagaacctaccaccggttcctgacctggcctgttccctactgc
agcatctaccaggagctgctcaccttcattgatgctgaactcaaggccccaggaatcacc
taccagcgactggtgagggccgagcagggcctgcccattagaagtcaccgcagctccacc
gtcaccgtgctgttgctgaacccagttgaggtgcaggctgagttcctcgctgtggccaac
aagctgagcacgcccgggcactcgccccacagcgcctacaccaccctgctcctgcacgcc
ttccaggccaccttcggggcccactgtgacctcccagggctgcacggcaggctgcagtcc
aagagcctggccgagctcgaagacatcttcacggagactgcggaagctcaggagctggct
tctggcatcggggacgcagccgaggcccggcagtggctcaggaccaggctgcaggcggtg
ggagagaaagctggcttccccggcgtgttagacactgccaaacctggccagctccgcacc
atccccatccctgtcgccaggtgtcacacttacagctggaaccaggacagcttcgacatc
ctgcaggaaatcctgctcaaggaacaggagctactgcagccagggatcctgggggacgat
gaagaggaggaggaggaggaagaagacttggaaacggacgggctttgtgcccagagggac
tcactgctctccaccagctcggcggtcttccacgactccgacctgtccctcgcctcctcc
caggcctcggggcccgccctctcccgccagctgctgacctccttcgtctcgggcctctca
gacggcgtggacagcggctacgtggaggacagcgaagagagccccaccgagtggcccaag
aggccgggcggccaggagcgccggggccaccgcaggcccgggcagaagttcaacaggatc
tataaactcttcaagagcaccagccagctggtgctgcggagggactcccggggcctggag
gggggctcggtctcgggcctgccgctgcggcgggcggggagcctctgcagccccctggac
ggcccggtgccaccgccgccgccgccgccccccgcgcgggcccagcgctcgcgctccctg
ccccagcccaagctcagcgcccagctgcccagctggctcctggcccccgcctcgaggcac
cagcgccgccggcccttcctgagcggagacgaggaccccaaggcgtccacactacgcgtc
gtggtcttcggctccgatcggatttcggggaaggtggctcgggcctacagcaacctgcgg
cagctggagaacaaccacccgctcctcacacggttcttcaagcttcagttcttctacgtg
cccgtgaagcgaggccaggggaccggctccagtgcctgccccgcccccgccagccagacg
cccccaccccccacagactccccgaggcaccccagccctgcggagctggagagcaccaat
gacatctcccactacctcggcatgctcgacccctggtatgagcgcaacgtgctgggcctc
atgcacctgccccccgaagtcctgtgccagcagtctctgaaggcggaatcccggcccctg
gacggctcctcagcccagctgcccatcctggcggacatgctcctctattactgtcgcttc
gccgcccggccggtgctgctgcaggtctatcagacagagctgactttcatcaccggggag
aagatgaaagagatcttcatccactccctggagctgggtcactctgctgccacacgtgcc
atcagggcttcgggtcctggcagcaagcgtctgggcatcgatggtgaccgcgaggccatc
cctctaacactacagattatttacagcaagggggccatcagtggacgaagccgctggagt
aacatggagaaggtgtgcacctctgtcaatcttagcaaggcctgccagaagcaggaggag
ctagactccagcatggaggccctgacgctaaacctgacagaggtggtgaaaaggcagaac
cccaagtccaagaagggcttcaaccagattagcacatcacagatcaaggtggacaaggtg
cagatcatcggctccaacggctgccccttcgcggtgtgcctggaccaggatgagaggaag
atcctgcagagtgtggtccggtgtgaggtctcaccttgctacaagccagagaagagcagc
ctccacccccaaccccagaggtccctggacccgccaacacaggccccgccggacctctgc
tccctcctctgcctgcccatcatgacgttcagtggagctctgccctag

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101375062
Entry
101375062         CDS       T05148                                 

Gene name
PIK3R6
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 6
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04022  cGMP-PKG signaling pathway
oro04062  Chemokine signaling pathway
oro04072  Phospholipase D signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04371  Apelin signaling pathway
oro04611  Platelet activation
oro04725  Cholinergic synapse
oro04921  Oxytocin signaling pathway
oro05145  Toxoplasmosis
oro05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101375062 (PIK3R6)
   04072 Phospholipase D signaling pathway
    101375062 (PIK3R6)
   04022 cGMP-PKG signaling pathway
    101375062 (PIK3R6)
   04151 PI3K-Akt signaling pathway
    101375062 (PIK3R6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101375062 (PIK3R6)
   04062 Chemokine signaling pathway
    101375062 (PIK3R6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101375062 (PIK3R6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101375062 (PIK3R6)
  09156 Nervous system
   04725 Cholinergic synapse
    101375062 (PIK3R6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101375062 (PIK3R6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101375062 (PIK3R6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101375062 (PIK3R6)
Membrane trafficking [BR:oro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101375062 (PIK3R6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 101375062
NCBI-ProteinID: XP_004398501
UniProt: A0A2U3VT98
LinkDB
Position
Unknown
AA seq 755 aa
MESSDVELDLQRSVQAVLRELSSQAPALQNNQGMWRWSLHKKVERDPGKSPVLVRILLRE
LEKAESEDLRHVIIPLLHTLLYVLTKATGITEELYRRTYSFCTRLLTLPAPYCTVALDCA
IRLKTETAVPGTLYQRLVIAEQNLTSEMYPYQERVFLFVDPELVSPSVCSALLLEIEAAQ
AQQTPEACMRHVVSHALQAVLGDACHASALQRKLKASPRHALERYFHAVVAAVEQMAGEP
NPSREGHLERLEEIYCSLLGPAAAARESCCGDRLQDPQPSIPLPSPHITFHLWTDEEQLW
KELVLFLRPRSQLRLSADLEALDLQGLWPDRELARASMLSTDSGIERDLPAGADELPVPS
SPEMERAGLQRKGGIKKRMWPPDVLMPACWDGPQGLHRRTGMPSGDGELLPGVSRLHTAR
VLVLGDDRMLGRLAQAYHSLRKRETQKFCLTPRLSLQLYYIPVLAPEELPSCRHSELREL
ATFLGRADPWYQSTVNTLCPAIHKLAEMPPSLDTSRTVDPFILDVITYYVRMGTQPIYFQ
IYTVKIFRDLSQDPAEDIFLTELKVKIQDSKFPKDGFSPRRKGAAEGPGAELSICYQKAL
LSHRAQEVSSSLRATGLVLKALPASDTEGSGPTHAPPPAAPVIDHRCLNVNVMEVVKSSN
LAGRSFSTVMNTFRTATIQIQSQDQRLLTLLLDKDSRRTYRDVVRFEVAPCPEPCSGMHK
SKAPCFGSPQPEVEGTKAKPKPLLMPINTFSGIVQ
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggagagctcagatgtggagctggacctccagcggagtgtgcaggcagtgctccgggag
ctcagcagccaggccccagccctgcagaacaaccaaggcatgtggaggtggtccctgcac
aagaaggtcgagcgagatcctggtaagagtccggtgctggtccgcattctgctcagagaa
ctggaaaaggcagaaagcgaagacctccggcatgtcatcattcccttgctgcataccctc
ctgtacgtgctcactaaggccaccggcatcacggaggagctctaccggagaacctacagc
ttttgcacgaggctgctaaccctgcccgccccctactgcacagtagccttggactgcgcc
ataaggctgaaaacagagacagctgtcccagggacactgtaccaaaggctggtcattgcc
gaacagaacctgacaagtgagatgtacccctaccaggagagagtgttcctcttcgtggat
cctgagctggtatctccctccgtgtgcagcgccctgctgctggagatcgaggcggcccag
gcgcagcagaccccggaggcctgcatgcgccacgtggtctcccacgccctgcaggctgtg
cttggggacgcctgccatgcaagtgccctgcagaggaagctgaaggccagccctcgccac
gccctggagcgctatttccacgccgtggtggcggccgtggagcagatggccggcgaaccc
aacccgagccgggagggacacctggagaggctagaggagatttactgctcgctgttgggg
ccggcggcggccgccagggagagctgctgcggtgaccgcctgcaggacccgcagccaagc
atccctctgcccagcccccacatcaccttccacctgtggaccgatgaggagcagctctgg
aaggaactggtcctcttcctgcgtccgcgatcccagttgcgcctcagtgctgacttggag
gccttggatctgcagggcctctggccagaccgggagctggcccgggcgtccatgctgtcc
accgacagtggcatcgagcgggacctccctgcaggggccgacgagctgcctgtccccagc
agccctgagatggagcgtgccgggctgcagcgcaaaggaggcatcaagaagcggatgtgg
ccccccgacgtcttgatgcctgcgtgctgggacgggccccaggggctgcaccgcaggacg
ggcatgcccagtggggatggggagctactgcccggtgtctcccggctccacacggccagg
gtgctggtgctgggggatgacaggatgctggggcgcctggcccaggcctaccacagcctc
aggaaacgagagacccagaagttttgcctcacccccagactcagcctgcagctctactac
atccccgtgttggcgcccgaggagctgccgtcatgcagacattcagagctcagagagctg
gccacgttcctgggccgcgcagacccgtggtaccagagcaccgtcaacacactatgcccg
gccatccacaagctggcagagatgcccccttccctggacacatcccggactgtggacccc
ttcatcctggatgtcatcacctactacgttcgcatgggcacccaacccatctacttccag
atctatactgtcaagatcttcagggacctgagccaagaccccgcagaggacattttcctc
actgagctgaaggtgaagatccaagactccaaattccccaaagatggcttttcacccagg
aggaagggcgcggccgagggcccaggggccgagctgtccatctgctaccagaaggccctg
ctcagccaccgcgcccaagaggtctccagttccctgcgggccactgggctggtcctgaag
gcccttccagccagtgacactgagggttcagggcccacccacgcccccccacctgctgct
ccagtcatagaccacaggtgcctgaatgtcaacgtgatggaggtggtcaagtcctccaac
ttggcgggcaggtccttctctacagtgatgaacaccttccggacagccaccatccagatc
cagagccaggaccagaggctcctgacgctgctgctggacaaggacagtcgacgcacgtac
agggatgtggtcaggttcgaggttgctccctgcccagagccgtgttccgggatgcacaag
tccaaggcgccgtgcttcggttcaccccagccggaggtggaagggaccaaagccaagccc
aagccccttctgatgcccatcaacacgttctccggcatcgtccagtga

DBGET integrated database retrieval system