KEGG   Odobenus rosmarus divergens (Pacific walrus): 101362287
Entry
101362287         CDS       T05148                                 

Gene name
CD2
Definition
(RefSeq) T-cell surface antigen CD2
  KO
K06449  T-cell surface glycoprotein CD2
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04514  Cell adhesion molecules
oro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101362287 (CD2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101362287 (CD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101362287 (CD2)
   04090 CD molecules [BR:oro04090]
    101362287 (CD2)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101362287 (CD2)
CD molecules [BR:oro04090]
 Proteins
  101362287 (CD2)
SSDB
Motif
Pfam: V-set Ig_3 C2-set I-set Ig_2 RACo_C_ter EphA2_TM Shisa DUF2500 SARAF Chordopox_A30L
Other DBs
NCBI-GeneID: 101362287
NCBI-ProteinID: XP_004414703
UniProt: A0A2U3WYI3
LinkDB
Position
Unknown
AA seq 347 aa
MSLACQILASFLLIFIVSTKGAAPENNVVWGTLGQDFNLNITGFQMNDDIDDIRWEKGKI
KVARLKMGKLKETDKRYNVSTNGALKIKHLKIEDSDSYRVVIYATNGKNILDKTFLLKIQ
EEVSLPVMFWSCTNRNLTCEIRSGTDPELMLYLDNTLLDNAASKTISRVIATNKWTTKRR
MSFNCTAKNKVSKQNRRETIDCSEKGLDLYLIVGICGGGIIFIIFMTLLIFYINKRKKQN
SRRNDEELEIRTRRVTTKERRQKPRQFPGSAPQNPAVSQAPPPPSHRPQVPCHRSPPPSH
RVQHHPQKKAPPPSATHVHQQKGPPLPRPRVQPKPPHGAQKTHNSVS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgagcctcgcatgtcaaatcttagccagcttccttctgattttcatcgtttctaccaaa
ggtgcagcccctgaaaacaatgttgtctggggtaccctgggtcaagacttcaacctgaac
attactggttttcaaatgaatgatgatatagatgatatacgatgggaaaagggcaaaatc
aaggttgcacgactcaaaatgggcaagcttaaagagacagataaaagatacaatgtatca
acaaacggagctctgaaaattaaacatctgaagatagaggacagtgattcctacagggtg
gttatatatgctacaaatggaaagaacatattggacaaaacatttctactgaagattcaa
gaggaggtttcactacctgtgatgttctggagttgtaccaacagaaacctgacctgtgag
ataaggagtggaactgaccccgaattaatgctgtatctagataatacattattagataat
gctgcatctaaaactatttctcgggtgattgccacaaacaagtggacgaccaaacggcgt
atgtcattcaactgcacggcgaagaacaaagtcagtaagcaaaacagacgggagaccatc
gattgttcagagaagggtctggacttgtatctcattgttggtatctgcggaggaggcatc
atcttcatcatctttatgacactactcattttctacatcaacaagagaaaaaagcagaac
agtaggagaaatgacgaggagctggagataagaacacgcagagtaaccaccaaggagagg
cgccagaagccccgccagtttccaggatcagctcctcaaaatccagctgtgtcccaagct
cctccaccacctagtcatcggccccaggtcccttgtcatcggtccccgcctccgagccac
cgtgtccagcaccacccacagaagaaggctcctcctccgtcagccacccacgttcaccag
cagaaaggtcctcccctccctaggcctcgagttcaaccaaaacctccccatggggcacag
aaaactcataactctgtctcctga

DBGET integrated database retrieval system