KEGG   Odobenus rosmarus divergens (Pacific walrus): 101362774
Entry
101362774         CDS       T05148                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01522  Endocrine resistance
oro04012  ErbB signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04110  Cell cycle
oro04151  PI3K-Akt signaling pathway
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04934  Cushing syndrome
oro05162  Measles
oro05165  Human papillomavirus infection
oro05169  Epstein-Barr virus infection
oro05200  Pathways in cancer
oro05202  Transcriptional misregulation in cancer
oro05203  Viral carcinogenesis
oro05206  MicroRNAs in cancer
oro05215  Prostate cancer
oro05220  Chronic myeloid leukemia
oro05222  Small cell lung cancer
oro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101362774 (CDKN1B)
   04066 HIF-1 signaling pathway
    101362774 (CDKN1B)
   04068 FoxO signaling pathway
    101362774 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    101362774 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101362774 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101362774 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    101362774 (CDKN1B)
   05206 MicroRNAs in cancer
    101362774 (CDKN1B)
   05203 Viral carcinogenesis
    101362774 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    101362774 (CDKN1B)
   05220 Chronic myeloid leukemia
    101362774 (CDKN1B)
   05215 Prostate cancer
    101362774 (CDKN1B)
   05222 Small cell lung cancer
    101362774 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101362774 (CDKN1B)
   04934 Cushing syndrome
    101362774 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    101362774 (CDKN1B)
   05169 Epstein-Barr virus infection
    101362774 (CDKN1B)
   05165 Human papillomavirus infection
    101362774 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101362774 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101362774
NCBI-ProteinID: XP_004411128
UniProt: A0A2U3WPN5
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHSRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGNRQAVPLIG
SQANSEDTHLVDQKTDTPDNQTGLAEPCTGIRKRPATDDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctagagcggatggacgccagacag
gcggagtaccccaagccctccgcctgcagaaacctcttcggcccggtcaaccacgaagag
ttgacccgggacttggagaagcacagcagagacatggaagaggcaagccagcgcaagtgg
aattttgatttccagaatcacaagcccctggagggcaaatacgagtggcaggaggtggag
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggaaagccaggacgtcagcgggaaccgccaggcggtgcctttaattggg
tctcaggcaaactcagaggacacacacttggtagaccaaaagactgatacgcccgacaac
cagaccgggttagcggagccgtgcactgggataaggaagcgacctgccacagacgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtctcagacggttccccaaac
gcgggttcagtggagcagacgcccaagaagccgggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system