KEGG   Odobenus rosmarus divergens (Pacific walrus): 101362812
Entry
101362812         CDS       T05148                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01524  Platinum drug resistance
oro04115  p53 signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04210  Apoptosis
oro04215  Apoptosis - multiple species
oro04370  VEGF signaling pathway
oro04919  Thyroid hormone signaling pathway
oro05010  Alzheimer disease
oro05012  Parkinson disease
oro05014  Amyotrophic lateral sclerosis
oro05016  Huntington disease
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05134  Legionellosis
oro05145  Toxoplasmosis
oro05152  Tuberculosis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05200  Pathways in cancer
oro05210  Colorectal cancer
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05215  Prostate cancer
oro05222  Small cell lung cancer
oro05223  Non-small cell lung cancer
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101362812 (CASP9)
   04151 PI3K-Akt signaling pathway
    101362812 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101362812 (CASP9)
   04215 Apoptosis - multiple species
    101362812 (CASP9)
   04115 p53 signaling pathway
    101362812 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101362812 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101362812 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101362812 (CASP9)
   05212 Pancreatic cancer
    101362812 (CASP9)
   05215 Prostate cancer
    101362812 (CASP9)
   05213 Endometrial cancer
    101362812 (CASP9)
   05222 Small cell lung cancer
    101362812 (CASP9)
   05223 Non-small cell lung cancer
    101362812 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101362812 (CASP9)
   05012 Parkinson disease
    101362812 (CASP9)
   05014 Amyotrophic lateral sclerosis
    101362812 (CASP9)
   05016 Huntington disease
    101362812 (CASP9)
   05020 Prion disease
    101362812 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    101362812 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101362812 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101362812 (CASP9)
   05152 Tuberculosis
    101362812 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101362812 (CASP9)
   05161 Hepatitis B
    101362812 (CASP9)
   05160 Hepatitis C
    101362812 (CASP9)
   05164 Influenza A
    101362812 (CASP9)
   05162 Measles
    101362812 (CASP9)
   05168 Herpes simplex virus 1 infection
    101362812 (CASP9)
   05163 Human cytomegalovirus infection
    101362812 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101362812 (CASP9)
   05169 Epstein-Barr virus infection
    101362812 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101362812 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101362812 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101362812 (CASP9)
   01002 Peptidases and inhibitors [BR:oro01002]
    101362812 (CASP9)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     101362812 (CASP9)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101362812 (CASP9)
Peptidases and inhibitors [BR:oro01002]
 Cysteine peptidases
  Family C14: caspase family
   101362812 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 101362812
NCBI-ProteinID: XP_004397165
UniProt: A0A2U3VQ26
LinkDB
Position
Unknown
AA seq 451 aa
MDEADRQLLRRCRVRLVRELQVASLWDVLLSRQLFTPAMIEDIQHAGSGSRSDQARQLVI
DLETRGSQALPLFISCLEDTDQDALASFLRMSRQAQKQNPEAVRPPNLMPVVLGPMGLTP
EDLRGKTGPLKPTPGKLSPVVLGPEQLWPAKLRPEVLRPEVPRPVDSGSGRFSDVCAQEI
SKQNPDLAYALNADPCGHCLIVNNVNFCLESNLMARTGSNIDCEKLQQRFRLLHFTVEVK
CDLKAKQMVQALVELARRDHSGLDCCVVVVLSHGCQASHRQFPGAVYGTDGCPVSIEKIV
NIFNGASCPSLGGKPKLFFIQACGGEQKDHGFEVACASPEDRTSGSDPESDAAPFQEGLG
PFDQPDAVSSLPTPSDIFVSYSTFPGFVSWRDTKRGSWYVETLDGVFEQWAHSEDLQTLL
LRVANAVSQKGIYKQIPGYFNFLRKKLFFKM
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggacgaggccgaccggcagctcctgcggcgatgccgggtgcggctggtccgcgagctg
caggtggcctcgctctgggacgttctcctgtcccgccagctcttcacgcccgccatgatc
gaggacattcagcatgcaggctcggggtctcggagcgatcaggccaggcagctggtcata
gatctagagacccgagggagtcaggcccttcctttgttcatctcctgcttagaggacaca
gaccaggatgcgctggcttcattcctgagaatgagtcggcaagcacaaaagcagaatcca
gaggctgtcagacccccgaacctcatgcctgtggtgcttggaccaatgggcctcacacca
gaggatctcagagggaagacgggtccattaaagccgactccgggaaaactctctccagtg
gtgctggggcctgagcagctctggccagccaagctcaggccagaggttctcagaccagag
gtgcccaggccagtggacagtggttctggacgattcagtgatgtctgtgctcaggagatt
tccaagcaaaatcctgatttggcatacgccctgaatgcagacccctgcggccactgcctc
atcgtcaacaacgtgaacttctgcctcgagtcgaacctcatggcccgcaccggctccaat
atcgactgtgaaaagctgcagcaacgcttccgcttactgcatttcacggtggaggtgaag
tgtgacctgaaggccaagcaaatggtccaggctttggtggagctggcgcggcgggaccac
agcggcctggactgctgcgtggtggttgtcctctctcacggctgtcaggccagccaccgc
cagttcccaggggctgtttatggcacggatggatgtcctgtgtccatcgagaaaattgtg
aacatcttcaatggagccagctgccccagcttgggagggaagcccaagctcttcttcatc
caggcctgtggtggggagcagaaagaccatgggtttgaggtggcctgcgcttcccctgaa
gacaggacctctggcagtgacccggagtcagacgctgccccattccaggaaggcctaggc
ccctttgaccagccggacgctgtgtctagtttgcccacacccagtgacatcttcgtgtcc
tactccaccttcccaggctttgtttcctggagggataccaagaggggctcctggtacgtg
gagaccttggatggtgtttttgagcagtgggctcactctgaagacctgcagaccctcctg
ctcagggtcgctaatgctgtttcacagaaagggatttacaaacagattcccggttatttc
aatttcctccggaaaaaactcttttttaaaatgtga

DBGET integrated database retrieval system