KEGG   Odobenus rosmarus divergens (Pacific walrus): 101362815
Entry
101362815         CDS       T05148                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04024  cAMP signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04110  Cell cycle
oro04310  Wnt signaling pathway
oro04330  Notch signaling pathway
oro04350  TGF-beta signaling pathway
oro04520  Adherens junction
oro04630  JAK-STAT signaling pathway
oro04720  Long-term potentiation
oro04916  Melanogenesis
oro04919  Thyroid hormone signaling pathway
oro04922  Glucagon signaling pathway
oro04935  Growth hormone synthesis, secretion and action
oro05016  Huntington disease
oro05152  Tuberculosis
oro05161  Hepatitis B
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05206  MicroRNAs in cancer
oro05211  Renal cell carcinoma
oro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101362815 (EP300)
   04330 Notch signaling pathway
    101362815 (EP300)
   04350 TGF-beta signaling pathway
    101362815 (EP300)
   04630 JAK-STAT signaling pathway
    101362815 (EP300)
   04066 HIF-1 signaling pathway
    101362815 (EP300)
   04068 FoxO signaling pathway
    101362815 (EP300)
   04024 cAMP signaling pathway
    101362815 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101362815 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101362815 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101362815 (EP300)
   04935 Growth hormone synthesis, secretion and action
    101362815 (EP300)
   04919 Thyroid hormone signaling pathway
    101362815 (EP300)
   04916 Melanogenesis
    101362815 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    101362815 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101362815 (EP300)
   05206 MicroRNAs in cancer
    101362815 (EP300)
   05203 Viral carcinogenesis
    101362815 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101362815 (EP300)
   05215 Prostate cancer
    101362815 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101362815 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101362815 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101362815 (EP300)
   05161 Hepatitis B
    101362815 (EP300)
   05164 Influenza A
    101362815 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101362815 (EP300)
   05165 Human papillomavirus infection
    101362815 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101362815 (EP300)
   03036 Chromosome and associated proteins [BR:oro03036]
    101362815 (EP300)
   03029 Mitochondrial biogenesis [BR:oro03029]
    101362815 (EP300)
Enzymes [BR:oro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101362815 (EP300)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    101362815 (EP300)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101362815 (EP300)
Mitochondrial biogenesis [BR:oro03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101362815 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 101362815
NCBI-ProteinID: XP_004397482
UniProt: A0A2U3VQL3
LinkDB
Position
Unknown
AA seq 2421 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSAAGMMNSPVNQPAMGMNTGMNAGMNPGMLN
AGNGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGNAGSLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQIGAGGLGLQIQTKSVLPNNLSPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTSNLLSDSMLHSAINS
QNPMMSENASVASLGPMPTAAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQPGLNQFGQMG
MPQPPIGPRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQTQFSTQGMNVTN
MPLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQSALHQNSPSPVPSRT
PTPHHTPPSIGAQQPPATIPAPVPTPPAMPPGPPTQALHPPPRQTPTPPPTQLPPPVQPS
LPAAPSAEQPQQQPVSQQSATASAPTPTAPLLPPQPSTPLSQPAVSIEGQVSNPPSTSST
EVNSQTIPEKQSSQEVKMEAKMEVDPPEPADAQPEDIPETKAEDCKMEPIETEERGTELK
TETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVD
PQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYK
YCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
HHEIIWPSGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGE
VTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQE
YGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPP
SEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKE
LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNK
SSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIP
CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNSQQAAATQSPGDSRRLSIQRCIQ
SLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTG
QQPATPQTPQPPPPSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPL
PGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMSMNPPPMARGPSG
HLEPGMGPTGMQQQPQWVQGGLPQPQQLQPGMQRPAMMSVAQHGQPLNIAPQPGLGQVGV
SPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQ
PLPGQPGMPQGQPGLQPPAMPGQQGVHSNAAMPNMNPMPAGVQRAGLPQQQPQQQLQPPM
GGMSPQAQQMNMNHNAMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVG
YPPPPPQPQPQPRMQHHMQQMQQGSMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPA
QPNPMSPQQHMLPSQAQSPHLQGQQIPSSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQP
QPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQSSMLSQLASNPGMANLHGASATDL
GLSTDNSDLNSNLSQSTLDIH
NT seq 7266 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtcggccagcgatggcacagattttggctctctgtttgatttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacaa
ctgtcagaattgctacggtctggtagttcccctaacctcaatatgggggttggtggccca
ggccaaggcatggccagccaggcccaacagaatagtcctggattaggtttgataaatagc
atggttaaaagcccaatggcacaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcctacgccatctgcagcaggtatgatgaacagtccagtaaat
cagcctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttgaat
gcaggcaatggacaggggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgacctaacatgcagtacccaaacccaggcatgggaaatgctggcagtttaatg
accgagccactgcagcaaggctctcctcagatgggaggacaaacgggattgagaggccct
cagcctcttaagatgggaatgatgaacaaccctaatccttatggttcaccatacactcag
aattctggacagcagattggagccggtggtcttggtctccagattcagacaaagtctgta
ctaccaaataacttatctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaacatgggtcaacagcaggccccacaggtccagcagccaggccttgtgactccagta
gcccaagggatgggttctggagcacatacagctgatccagagaagcgcaagctcatccag
cagcagcttgttctccttttgcatgctcacaagtgccagcgccgggagcaggctaatggg
gaagtgaggcagtgcaatcttccccactgtcgcacaatgaagaatgtcctaaaccacatg
acacactgccagtcaggcaagtcctgccaagtggcacactgtgcttcttctcgacaaatc
atttcacactggaagaattgtacaagacatgattgtcctgtgtgtctcccccttaaaaat
gctggagataagagaaaccaacagtcaattctgactggagcaccagttggacttggaaat
actagctctctaggggtgggtcaacagtctacccccagcctaagcactgttagtcagatt
gatcccagctctatagaaagggcgtatgcagctctcgggctgccctatcaagtaaatcaa
atgccgacgcagccccaggtgcaagcaaagaaccagcagaatcagcagtctgggcaatct
ccccaaggcatgcggcccatgagcaacatgagtgctagtccaatgggagtaaatggaggt
gtaggggttcaaacgtcgaatcttctttctgactcaatgttgcattcagccataaattct
caaaatccaatgatgagtgaaaatgccagtgtggcctccctgggtcctatgccaacagca
gctcaaccatccaatactggaattcggaaacaatggcatgaagatattactcaggatctt
cgaaatcatcttgttcacaaacttgttcaagccatatttcctactccggatcctgctgct
ttaaaagacagacggatggaaaacttagttgcatacgcccggaaagtggaaggggacatg
tatgaatctgcaaataatcgagcggaatactaccacctgctagctgagaagatctataag
atccagaaagaactagaagaaaaacgaaggactagactacagaaacaaaacatgctgccc
agtgctgcaggcatggtgccagtttctatgaatccagggcccaatatggggcagccacaa
ccaggaatgacttccaatggccctctacctgacccatctatgatccgtggcagtgtgcca
aaccagatgatgcctcggataactccacagcctggtttgaatcagtttggccagatgggt
atgccccagcccccaattggaccccggcaaacttctcctcttcagcaccatggacagtta
gctcagcctggaactctcaacccacctatgggctatgggcctcgcatgcagcagccttcc
agccagagccagttccttccccagactcaattctcaacacagggaatgaatgtaacgaat
atgcctttggctccgtctggcgggcaagcaccggtgtcccaagcacaaatgtccagttct
tcctgccctgtgaactctcctataatgcctccagggtctcaagggagccacattcactgt
ccccctctccctcagtcagctctgcatcagaattcaccctctccagtacctagtcgtacc
cctacgcctcaccacactcccccgagcataggggctcagcagccaccagcaacaattcca
gcccctgttcctacacctccagccatgccacccgggccaccgacccaggccctccatcca
cctccaaggcagacacctacaccaccaccgacgcagcttcctcctccagttcagccttcg
cttcctgctgctccttcagctgagcagccgcagcagcagcctgtctcccagcagagcgcc
acggcttctgcccccaccccgacggcgccgctgctgcccccacagccttcgactccactt
tcccaaccagctgtaagcattgaagggcaggtatcaaacccaccatccactagtagcaca
gaagtgaattctcagaccattcctgagaagcagtcttcacaggaagtgaaaatggaggca
aagatggaagtggatccaccagaaccagctgatgctcagccagaggatattccagagact
aaagcagaagactgtaaaatggaacctatagaaacagaagagagaggcactgaattaaag
actgaaacaaaagaggaggaagaccagccaagtacttcagctacccagtcatctccagcc
ccgggacagtcaaagaagaagattttcaaaccagaagagttacgacaggcactgatgcca
actttggaggcactttaccgacaggatccagaatcccttccctttcgtcaacctgtggac
cctcaacttcttggaatccctgattactttgatattgtgaagagccccatggacctttct
accatcaagaggaagttagacactggacagtatcaggagccctggcagtatgtggatgac
atttggcttatgttcaacaatgcctggttgtataatcggaaaacatctcgggtatacaaa
tactgctccaagctgtctgaagtctttgaacaagaaattgacccagtaatgcaaagcctt
ggatattgttgtggcagaaagttggagttctctccacagacactctgttgctatggcaaa
cagttatgcacaatccctcgtgatgccacttactacagttaccagaacaggtatcatttc
tgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgacccttcc
cagcctcaaactacaataaataaagaacaattttccaagagaaaaaatgacacactggat
cctgaactgtttgttgaatgtacagagtgtggaagaaagatgcatcagatctgtgtcctt
catcatgaaatcatctggccatctggatttgtctgtgatggctgcttaaagaaatctgca
cgaaccaggaaagaaaataagttttctgctaaaaggttgccatccaccaggcttggtacc
tttctggagaatcgtgtgaatgactttcttaggcgacagaatcaccctgagtcaggagag
gtcactgttcgggtagttcatgcttctgacaaaactgtggaagtgaaaccaggcatgaaa
gcaaggtttgtagatagtggagagatggcagaatcctttccataccgaaccaaagccctc
tttgcctttgaagagatagacggtgttgacttgtgcttctttggcatgcatgttcaagag
tatggctctgactgccctccacccaaccagaggagagtttacatatcataccttgacagt
gttcatttcttccgtcctaaatgcttgaggactgcagtctaccatgagattctaattgga
tatttagaatacgtcaagaaattaggatatacaacagggcatatttgggcttgtccccca
agtgagggagacgactatatcttccattgccatcctcctgaccagaagatacccaagccc
aagcgactgcaggagtggtacaaaaagatgcttgacaaggccgtgtctgagcgaatcgtc
catgactacaaggatatttttaaacaagctactgaagatcgattaacaagtgcaaaggag
ttgccttactttgagggtgatttctggcccaatgttctggaagagagcattaaggaactg
gaacaggaggaggaagagcgaaagcgagaagaaaacaccagcaacgagagcacagatgtg
acaaagggagacagcaaaaatgctaaaaagaaaaataataagaaaaccagcaaaaacaag
agcagcctgagtaggggcaacaagaagaagccaggcatgcccaacgtgtccaatgacctc
tcgcagaaactgtatgccacgatggagaaacacaaagaggtcttctttgtgatccgtctc
atcgctggccctgccgccaactccctgcctcccatcgtcgatcctgaccccctcatcccc
tgtgatctgatggatgggcgggacgccttccttaccctcgcaagggacaagcacctggag
ttctcttcacttcgaagagcccagtggtccaccatgtgcatgctggtggagctgcacacc
cagagccaggaccgcttcgtctacacctgcaacgagtgcaagcaccatgtggagacgcgc
tggcactgcactgtctgcgaggattatgatttgtgcatcacctgctacaacactaaaaac
cacgaccacaaaatggagaaactaggtcttggcttagatgacgagagcaacagccaacag
gctgcagccacccagagcccaggagactctcggcgcctgagcatccagcgctgcatccag
tccctggtgcacgcctgccagtgccgcaacgccaactgctcactgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgcaagcggaaaaccaacgggggctgcccc
atctgcaagcagctcatcgccctctgctgctaccacgccaagcactgccaggagaacaag
tgcccggtgcccttctgcctcaacatcaagcagaagctccggcagcagcagctgcagcac
cggctccagcaggcccagatgctccgcaggaggatggccagcatgcagcggaccggtgtg
gtggggcagcagcaaggcctgccctccccgactcctgccactcccaccacaccaacaggc
cagcagccagccacgccgcagacgccccagcccccgcctccctctcagcctcagcccacc
cctcccaacagcatgccaccctacttgcccaggactcaggctgctggccctgtctcccag
ggtaaggcggcgggccaggtgacacctcccacccctcctcagactgctcagccacccctg
ccggggccccctcctgctgcagtggagatggcaatgcagattcagagggcagctgagacg
cagcgccagatggcccacgtgcaaatttttcaaaggccaatccagcaccagatgccccag
atgactccgatggcccccatgagtatgaacccgccccctatggccagagggcccagtggg
catttggagccagggatggggcccacagggatgcagcaacagccacagtgggtccaagga
ggattgcctcagccccagcagctacagcctgggatgcagaggccagccatgatgtcagtg
gcccagcacggtcagcccttgaatatagctccccagccaggactgggccaggtaggtgtg
agccctctcaaaccaggcactgtgtctcaacaagccttacagaaccttctgcggactctc
aggtctcccagctctcccctacagcagcaacaggtgcttagtatccttcacgccaacccc
cagctgttggctgcattcatcaagcagcgggctgccaagtatgccaactcgaatccacag
cccctccctgggcagcctggcatgccccagggccagccggggctgcaaccgcctgccatg
ccaggccagcagggggtccactctaacgcagccatgccgaacatgaaccccatgccagcg
ggcgtccagagggctggcctgccccagcagcagccgcagcagcagctccagccacccatg
ggagggatgagcccccaagcccagcagatgaacatgaaccacaacgccatgccttcgcag
ttccgagacatcttgaggcggcagcagatgatgcagcagcagcagcaacagggagcggga
cccggaatcgggcccgggatggccaaccataaccagttccagcaaccccagggagttggc
tacccgccgccgccgccccagccccagccgcagccacggatgcagcatcacatgcagcag
atgcagcaagggagcatggggcagatgggccagctcccccaggccttgggagcagaggca
ggagccagcctgcaggcgtatcagcaacgactcctgcagcaacagatggggtcccctgct
cagcccaaccccatgagcccccagcagcatatgctcccaagccaggctcagtccccacac
ctccaaggccagcagatcccttcttctctctccaatcaagtgcgttctccccagcccgtc
ccttctccgcggccgcagtcccagcccccccactccagcccttccccacggatgcagcct
cagccttctccacaccacgtttccccacagaccagttctccacatcctggactggtagct
gcccaggccaaccccatggaacaagggcattttgccagcccggaccagagttcaatgctg
tctcagctcgctagcaatccaggcatggcaaacctccatggtgcaagcgccacggacctg
ggactcagcaccgataactcagacttgaattcaaacctctcacagagtacactagacata
cactag

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101386879
Entry
101386879         CDS       T05148                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04024  cAMP signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04110  Cell cycle
oro04310  Wnt signaling pathway
oro04330  Notch signaling pathway
oro04350  TGF-beta signaling pathway
oro04520  Adherens junction
oro04630  JAK-STAT signaling pathway
oro04720  Long-term potentiation
oro04916  Melanogenesis
oro04919  Thyroid hormone signaling pathway
oro04922  Glucagon signaling pathway
oro04935  Growth hormone synthesis, secretion and action
oro05016  Huntington disease
oro05152  Tuberculosis
oro05161  Hepatitis B
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05206  MicroRNAs in cancer
oro05211  Renal cell carcinoma
oro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101386879 (CREBBP)
   04330 Notch signaling pathway
    101386879 (CREBBP)
   04350 TGF-beta signaling pathway
    101386879 (CREBBP)
   04630 JAK-STAT signaling pathway
    101386879 (CREBBP)
   04066 HIF-1 signaling pathway
    101386879 (CREBBP)
   04068 FoxO signaling pathway
    101386879 (CREBBP)
   04024 cAMP signaling pathway
    101386879 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101386879 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101386879 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101386879 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    101386879 (CREBBP)
   04919 Thyroid hormone signaling pathway
    101386879 (CREBBP)
   04916 Melanogenesis
    101386879 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    101386879 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101386879 (CREBBP)
   05206 MicroRNAs in cancer
    101386879 (CREBBP)
   05203 Viral carcinogenesis
    101386879 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101386879 (CREBBP)
   05215 Prostate cancer
    101386879 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101386879 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101386879 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101386879 (CREBBP)
   05161 Hepatitis B
    101386879 (CREBBP)
   05164 Influenza A
    101386879 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101386879 (CREBBP)
   05165 Human papillomavirus infection
    101386879 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101386879 (CREBBP)
   03036 Chromosome and associated proteins [BR:oro03036]
    101386879 (CREBBP)
   03029 Mitochondrial biogenesis [BR:oro03029]
    101386879 (CREBBP)
Enzymes [BR:oro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101386879 (CREBBP)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    101386879 (CREBBP)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101386879 (CREBBP)
Mitochondrial biogenesis [BR:oro03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101386879 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 101386879
NCBI-ProteinID: XP_004403269
UniProt: A0A2U3W573
LinkDB
Position
Unknown
AA seq 2433 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELSLLNSGNLV
PDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLGAMGK
SPLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLA
ETLTQVSPQMASHAGLNTAQAGGMTKMGMTGNTSPFGQPFSQTGGQQMGAPGVNPQLSSK
QSMVNSLPPFPTDIKNASVTNVPNMSQMQTSVGIVPTQAIAAGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNAASLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSSPANIGTLSTIPTAAPPSSTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPSLPAPGAQPPGIPQTQPVRPPNGPMPLPVNRVQVSQG
MNSFTPMSLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHT
NNIMAQAPAQNQFLPQSQFQSSSGAMSVNSVGMGQPAAQTGVPQGQVPGATLPNPLNMLG
PQAGQLPCPPVTQSPLHQTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSSGQ
TPTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPP
GTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPMLEVKTEVKTEDAEPDASDSKGEP
GSAMMEEDLQGSSQVKEETDTTEQKSEPMEVDEKKPEVKVEAKEEEENNANGAASQSTSP
SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLST
IKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
YCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQ
PQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGR
TRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKS
RFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSI
HFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPK
RLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELE
QEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDL
SQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWE
FSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKS
HAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQK
MKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQH
RLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMS
PAGFPSVARTQPPTTVSTGKPANQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNI
NNGMPPGRTGMVTPVSQMAPVGLNVPRPSQVSGPVMPNLPPGQWQQAPLPQQQPMPGMAR
PVLSMQAQPAVAGPRMSGVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLM
AAFIKQRTAKYVASQPGLQPQPGLQPQPGLQAQPGLHQQPGLQNLNAMQAGGPRPGVPPQ
QQAMGGLNPQGQALNIMNPGHSPGMASMNPQYREMLRRQLLQQQQQQQGSAGMAGGMAGH
GQFQQPQGPGGYPPAMQQQRMQQHLPIQGGSMGQMAAQMGQLGQMGQPGLGADSTPNIQQ
ALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLSSQVRSPAPV
QSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSAML
PQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7302 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatccccaatggaggagaattaagccttttaaacagtgggaacctcgtt
ccagatgctgcttccaaacataaacaactgtcggagctactgcgtggaggcagcggctct
agtatcaacccaggaataggaaatgttagcgccagcagccccgtgcagcaaggccttggc
ggccaggctcaggggcagccgaacagtgcaaacatggccagcttgggtgccatgggcaag
agccctctgaaccagggagattcttcagcccccagcctgcccaaacaggcagccagcacc
tctgggcccactccccctgcttcgcaagcactgaatccgcaagcacaaaagcaggtgggg
ctggtgaccagcagccctgccacatcgcagacgggacctgggatctgcatgaatgctaac
tttaaccagacccacccaggcctcctcaatagtaactctggccatagtttaatgaaccag
gcccagcaaggacaggcgcaagtcatgaatggttctcttggggccgctggcagaggaagg
ggagctgggatgccgtaccctgctccagccatgcagggggccacaagcagtgtgctggcc
gagacgttaacacaggtttcaccgcaaatggccagtcacgccggactgaacacggcgcag
gcaggaggcatgaccaagatgggaatgactggtaacacaagtccattcggacaacccttt
agtcaaactggagggcagcaaatgggagcccctggagtaaacccccagttatccagcaaa
cagagcatggtcaatagtttgcctcccttccctacagacatcaagaatgcttcagtcacc
aacgtgccaaacatgtctcagatgcaaacttcagtgggaattgtccccacacaggcgatc
gcagcgggccccactgcagatcctgagaaacgcaaactgatacagcagcagctggttcta
ctgcttcatgctcataagtgtcagagacgagaacaagcgaacggagaggttcgggcctgc
tctctcccacactgtcgaaccatgaaaaatgttttgaatcacatgacacattgtcaggct
gggaaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtgggattcagaacacaattggttctgtt
ggcacaggccagcagaatgccgcgtctttaagtaacccaaatcccatagaccccagctcc
atgcagcgcgcgtacgctgctcttggactcccctacctgaaccagccccagacgcagctg
cagcctcaggttcccggccagcaaccagcacagcctcagactcaccagcagatgaggact
ctcaaccccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcag
cagccaccaaacttgatttcagaatcagctcttccaacttcccttggggccacaaaccca
ctgatgaacgatggctcgagccctgcaaacattgggaccctcagcactatacctacagcg
gcccctccttccagcactggcgttcggaaagggtggcacgaacacgtcactcaggacctg
cggagccatctagtgcataaactcgtccaagccatctttccaacccctgacccggcagcc
ctgaaggatcgccgcatggagaacctggtggcttacgctaagaaagtggagggggatatg
tatgagtctgccaacagcagggatgaatactatcacttactggcagaaaaaatctacaag
atacaaaaagaactagaagaaaagcggaggtcgcgtttgcacaaacaaggcatcttgggt
aaccagccctccctgccggctcccggggcgcagcccccagggattccgcagacacagcct
gtgaggcctccaaacggacccatgcccttgccggtgaaccgcgtgcaggtgtcccaaggg
atgaattcatttaccccgatgtccttggggaatgtacagttgccacaagctcccatggga
ccgcgtgcagcatcccccatgaaccactctgtcccaatgaacagcatgggctccgttcca
gggatggccatttctccttcccgaatgcctcagcctccgaacatgatgggcgctcacacc
aacaacattatggcccaggcgcctgcgcagaaccagttcctgccacagagccagttccaa
tcctccagtggggcgatgagcgtaaacagtgtgggcatggggcagccggcggcccagaca
ggcgtgccacagggacaggtgcctggtgccactcttcctaaccctctgaacatgcttggg
ccccaggccggccagctgccctgcccaccagtgacacagtcaccgttgcaccagacgcca
cctcctgcttccacggctgctggcatgccatctctccagcacccgacggcacctgggatg
actcctcctcagccagcagcccccacccagccatcgactcccgtgtcgtcttccgggcag
actcccaccccgactccaggctctgtgcccagtgctagccaaacccagagcacccctacg
gtccaggcagcagcccaggcccaggtgaccccgcagcctcagaccccagtccagcccccg
tctgtggccacccctcagtcatcacagcagcagccgacacctgtgcacacccagcctcct
ggcacaccgctttcccaggcagccgccagcatcgataacagggtccccactccttcctcg
gtggccagtgctgaaaccaactcccagcagccaggacccgacgtaccaatgctggaagtg
aagacagaggtcaagactgaggatgctgagcccgatgccagtgactccaagggggagcct
gggtctgcgatgatggaggaggatctacagggatcttctcaagttaaagaagaaacagac
acaacagaacagaaatcagaaccgatggaagtggatgagaagaaaccggaagtcaaagta
gaagctaaagaggaagaagagaacaacgctaatggggccgcctctcagtcaacatctcct
tcacagccacgcaagaaaatctttaagccagaggagttacgccaggctctgatgccaacc
ctcgaagcgctgtatcgacaggatccggagtccctaccttttcggcagcctgtagatcct
cagctcctaggaattccggattattttgacattgtgaagaatcccatggacctttccacc
atcaaacggaagctggatacagggcagtaccaagaaccctggcagtatgtggacgatgtc
tggcttatgttcaacaatgcctggctctataatcgtaagacgtcccgggtctataagttc
tgcagtaaacttgccgaggtctttgagcaagaaattgaccctgttatgcagtcccttgga
tattgctgtggacgcaagtatgagttttccccacagactttgtgctgctacgggaagcag
ctgtgtacaattcctcgtgacgctgcctactacagctatcagaataggtatcatttctgt
gagaagtgtttcacagagatccagggggagaatgttaccctgggtgacgacccttcacag
ccccagacgacaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagatcct
gaaccttttgttgattgcaaggagtgtggccggaagatgcatcagatttgtgttctgcac
tatgacatcatctggccttcaggctttgtgtgtgacaactgtttgaagaaaactggcaga
actcggaaagaaaacaagttcagtgctaagagactacagaccacacgattgggcaaccac
ttggaagaccgagtcaacaagtttttgcggcgacagaatcatcctgaagccggggaagtc
tttgtccgtgtggtggccagctcagacaagactgtggaggtcaagcccgggatgaagtca
cggtttgtggattctggggaaatgtcagaatctttcccgtatcgaaccaaagcgctcttt
gcttttgaggaaattgacggagtggatgtgtgcttctttgggatgcacgtgcaggaatat
ggctctgattgcccccctccaaatacaaggcgtgtgtacatatcttatctggacagtatt
catttcttccggccccgatgcctccggacagctgtttaccatgagatccttattggatat
ttagaatatgtgaagaaattggggtatgtaacaggacacatttgggcctgccccccaagt
gaaggagacgactatatcttccattgccacccccctgatcagaaaatccccaaaccaaag
cgcctacaggagtggtacaagaagatgctggacaaggcgtttgcggagcggatcattcat
gactacaaggacattttcaaacaagcaactgaagacaggctcaccagcgccaaggagctg
ccctattttgagggcgatttctggcctaatgtgctggaagagagcattaaggagttggag
caagaagaagaggagaggaagaaggaggagagcacggcggctagcgagacaacagagggc
agccagggcgacagcaagaatgccaagaagaagaacaacaagaaaaccaacaagaataaa
agcagcatcagtcgagccaacaagaagaagcccagcatgcccaatgtgtccaatgacttg
tcccagaagctctacgccacgatggagaagcacaaagaggtcttctttgtgatccacctg
cacgctgggcctgtcatcaacacgctgccccccatcgttgaccctgaccccctgctcagc
tgtgacctcatggatgggcgggacgccttcctcacactcgccagagacaagcactgggag
ttctcttccttgcgccggtccaagtggtccacactgtgcatgctggtggagctgcacacc
cagggccaggaccgcttcgtctacacctgcaacgagtgcaagcaccatgtggagacgcgc
tggcactgcaccgtgtgcgaggactatgacctttgcatcaactgctacaacaccaagagc
cacgcccacaagatggtgaagtgggggctgggcctggacgacgagggcagtagccagggc
gagccacagtccaagagcccccaggagtcgcggcgcctgagcatccagcgctgcatccag
tccctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccatcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacgggggctgtccg
gtgtgcaagcagctcatcgccctctgctgctaccacgccaaacactgccaagaaaacaaa
tgcccggtgcccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcac
cgcctgcagcaggctcagctcatgcgccggcggatggccaccatgaacacccgcaatgtg
cctcagcagagtctgccttcccctacctcagctccgcccgggacccccacacagcagccc
agcacgccccagacgccgcagcccccggctcaaccccagccctcacccgtgagcatgtca
ccagccggcttccccagtgtggcccggactcagccccccacgacggtgtccaccgggaag
cccgccaaccaggtgccagccccgccgccccccgcacagcccccaccagccgcggtggaa
gcggcccggcagattgagcgggaggcccagcagcagcagcacctgtaccgggtgaacatc
aacaacggcatgcccccggggcgcacgggcatggttaccccggtgagccagatggccccc
gtgggcctgaacgtgccccgtcccagccaggtcagtgggcccgtcatgcccaacctgcca
cccgggcagtggcagcaggcgcctctcccccagcagcagccaatgccgggcatggcccgg
cctgtgctgtccatgcaggcccagccggccgtggccggcccgcggatgtccggcgtgcag
ccgccccggagcatctcgcccggcgccctacaggacctgctgcggaccctgaagtcgccc
agctccccgcagcagcagcagcaggtgctcaacatcctcaagtccaacccgcagctgatg
gcggccttcatcaagcagcgcacagccaagtatgtggccagtcagcctggcctgcagccc
caacccggcctgcagccccagcccggcctccaggcccagcccggcctgcaccagcagccc
ggcctgcagaacctgaatgccatgcaagccggcgggccccggcccggcgtgcctccgcag
cagcaggcgatgggaggcctgaacccccagggccaggccctgaacatcatgaacccgggc
cacagccccggcatggcgagcatgaacccgcagtaccgggagatgctccgccggcagctg
ctccagcagcagcagcagcagcagggcagtgcaggcatggccgggggcatggccgggcac
ggccagttccagcagccccagggacccggaggctaccccccagccatgcagcagcagcgg
atgcagcagcacctccccatccagggcggctccatgggccagatggcggctcagatggga
cagctcggccagatggggcagccggggctgggcgcagacagcacccccaacatccagcag
gccctgcagcagcggattctgcagcagcagcagatgaagcagcagatcggctccccgggc
cagccgaaccccatgagcccccagcagcacatgctctcaggacaaccgcaggcctcgcac
ctccccggccagcagatggccacgtccctcagtagccaggtgcggtctccggcccctgtc
cagtctccgcggccccagtcccagcctccacattccagcccgtcgccacggatacagccc
cagccttctccacaccacgtctcgccccagactggttccccccacccaggactcgcagtc
accatggccagctccatagatcagggacacttggggaaccccgaacagagtgcaatgctc
ccgcagctgaacacccccaacaggagtgcgttgtccagtgagctgtccctggtcggcgac
accacaggagataccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system