KEGG   Odobenus rosmarus divergens (Pacific walrus): 101363063
Entry
101363063         CDS       T05148                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04020  Calcium signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04114  Oocyte meiosis
oro04218  Cellular senescence
oro04310  Wnt signaling pathway
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04625  C-type lectin receptor signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04720  Long-term potentiation
oro04724  Glutamatergic synapse
oro04728  Dopaminergic synapse
oro04921  Oxytocin signaling pathway
oro04922  Glucagon signaling pathway
oro04924  Renin secretion
oro05010  Alzheimer disease
oro05014  Amyotrophic lateral sclerosis
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05031  Amphetamine addiction
oro05152  Tuberculosis
oro05163  Human cytomegalovirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05170  Human immunodeficiency virus 1 infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101363063 (PPP3CA)
   04310 Wnt signaling pathway
    101363063 (PPP3CA)
   04370 VEGF signaling pathway
    101363063 (PPP3CA)
   04020 Calcium signaling pathway
    101363063 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    101363063 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101363063 (PPP3CA)
   04218 Cellular senescence
    101363063 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101363063 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    101363063 (PPP3CA)
   04660 T cell receptor signaling pathway
    101363063 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    101363063 (PPP3CA)
   04659 Th17 cell differentiation
    101363063 (PPP3CA)
   04662 B cell receptor signaling pathway
    101363063 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101363063 (PPP3CA)
   04921 Oxytocin signaling pathway
    101363063 (PPP3CA)
   04924 Renin secretion
    101363063 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    101363063 (PPP3CA)
   04728 Dopaminergic synapse
    101363063 (PPP3CA)
   04720 Long-term potentiation
    101363063 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    101363063 (PPP3CA)
   04380 Osteoclast differentiation
    101363063 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101363063 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101363063 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    101363063 (PPP3CA)
   05020 Prion disease
    101363063 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    101363063 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    101363063 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101363063 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101363063 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    101363063 (PPP3CA)
   05163 Human cytomegalovirus infection
    101363063 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101363063 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101363063 (PPP3CA)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101363063 (PPP3CA)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     101363063 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 101363063
NCBI-ProteinID: XP_004391521
UniProt: A0A2U3VB51
LinkDB
Position
Unknown
AA seq 521 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gtcccatttcctccaagtcaccggcttacagcaaaagaagtgtttgataatgatgggaaa
cctcgtgtggatatcttaaaggcacatctcatgaaggagggcaggctggaagagagcgtt
gcattgagaataataacagagggggcttcaattcttcgacaggaaaaaaatttgctggat
attgatgcaccagtcacagtttgtggggacatccatggacaattctttgacttgatgaag
ctttttgaagtggggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtctatgatgcctgtatggat
gcctttgactgcctgcccctggctgccctgatgaaccaacagttcctgtgtgtccacggc
ggtttgtctccggagattaacactttagacgatatcagaaaattagaccgattcaaagaa
ccacctgcttatggacctatgtgtgatatcctgtggtcagaccccctggaggattttgga
aacgagaagactcaggaacatttcactcacaacacagtcagggggtgttcgtacttctac
agttacccggctgtatgtgaattcttacagcacaataatttgttatctatactccgagcc
catgaagcccaagatgcagggtatcgcatgtacaggaaaagccaaacgacaggcttccct
tctctaattacgattttctcagcaccaaattatttagatgtatacaataacaaagctgca
gtattgaagtatgagaacaatgtcatgaatatcaggcaattcaactgttctcctcaccca
tactggcttccaaatttcatggatgttttcacttggtccctgccattcgttggggaaaaa
gtgactgagatgctggtaaatgtcctcaacatctgctcagatgatgaactagggtcagaa
gaagatggatttgatggagcgacagctgcagcccggaaggaggtgattaggaacaagatc
cgagcaataggcaaaatggcccgagtgttctcagttctcagagaagagagcgagagtgtg
ctgacgctgaaaggcttgacgcccacgggcatgctccccagcggagtgctttctggaggg
aagcagacactgcaaagcgctactgttgaggctattgaggctgatgaagcaatcaaagga
ttttcaccacaacataagatcactagcttcgaggaggccaagggcttagaccgaattaac
gagaggatgccacctcgcagagatgccatgccctctgacgccaaccttaactccatcaac
aaggctctcgcctcagagactaacggcacggacagcaatggcagtaatagcagcaatatc
cagtga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101363831
Entry
101363831         CDS       T05148                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X2
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04020  Calcium signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04114  Oocyte meiosis
oro04218  Cellular senescence
oro04310  Wnt signaling pathway
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04625  C-type lectin receptor signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04720  Long-term potentiation
oro04724  Glutamatergic synapse
oro04728  Dopaminergic synapse
oro04921  Oxytocin signaling pathway
oro04922  Glucagon signaling pathway
oro04924  Renin secretion
oro05010  Alzheimer disease
oro05014  Amyotrophic lateral sclerosis
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05031  Amphetamine addiction
oro05152  Tuberculosis
oro05163  Human cytomegalovirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05170  Human immunodeficiency virus 1 infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101363831 (PPP3CB)
   04310 Wnt signaling pathway
    101363831 (PPP3CB)
   04370 VEGF signaling pathway
    101363831 (PPP3CB)
   04020 Calcium signaling pathway
    101363831 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    101363831 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101363831 (PPP3CB)
   04218 Cellular senescence
    101363831 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101363831 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    101363831 (PPP3CB)
   04660 T cell receptor signaling pathway
    101363831 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    101363831 (PPP3CB)
   04659 Th17 cell differentiation
    101363831 (PPP3CB)
   04662 B cell receptor signaling pathway
    101363831 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101363831 (PPP3CB)
   04921 Oxytocin signaling pathway
    101363831 (PPP3CB)
   04924 Renin secretion
    101363831 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    101363831 (PPP3CB)
   04728 Dopaminergic synapse
    101363831 (PPP3CB)
   04720 Long-term potentiation
    101363831 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    101363831 (PPP3CB)
   04380 Osteoclast differentiation
    101363831 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101363831 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101363831 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    101363831 (PPP3CB)
   05020 Prion disease
    101363831 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    101363831 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    101363831 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101363831 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101363831 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    101363831 (PPP3CB)
   05163 Human cytomegalovirus infection
    101363831 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101363831 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101363831 (PPP3CB)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101363831 (PPP3CB)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     101363831 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 101363831
NCBI-ProteinID: XP_004407068
UniProt: A0A2U3WEN7
LinkDB
Position
Unknown
AA seq 524 aa
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDMDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFS
VLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFE
EAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHSAQ
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggccgccccggagccggcccgggctgcaccgcccccacccccgcccccgccgccccct
cccggggctgaccgcgtcgtcaaagctgtaccttttcccccaacacatcgcttgacatct
gaagaagtatttgatatggatgggatacccagggttgatgttctgaagaaccacttagta
aaagaaggtcgggtagatgaagaaattgcacttagaattatcaatgagggtgctgccatc
cttcggagagagaaaaccatgatagaagtagaggctccaattacagtgtgtggtgacatc
catggccaattttttgatctgatgaaactttttgaagtaggaggatcacctgctaataca
cgatacctttttcttggtgattatgtggacagaggttattttagtatagagtgtgtctta
tatttatgggtcctgaagattctgtacccaagcacattatttctcctgagaggcaatcat
gaatgcagacaccttactgaatattttacctttaagcaggaatgtaaaattaaatattca
gaaagagtctatgaagcttgtatggaagcttttgatagtctgcctcttgctgcactttta
aatcaacaatttctttgtgttcatggtggactttcaccagaaatacacacactggatgat
attaggagattagatagattcaaagagccacctgcatttggaccaatgtgtgacttgcta
tggtccgatccttctgaagattttggaaatgaaaaatcacaggaacattttagtcacaat
acagttcgaggatgttcttatttttataactatccagcagtgtgtgaatttttgcaaaac
aataatttgttatcgattattagagctcatgaagctcaagatgcaggctatagaatgtac
agaaaaagtcaaactacagggttcccttcattaataacaattttttcggcacctaattac
ttagatgtctacaataataaagctgctgtattaaagtatgaaaataatgtgatgaatatt
cgacagtttaactgttctccacatccttactggttgcccaattttatggatgtcttcaca
tggtctttaccatttgttggagaaaaagtgacagaaatgttggtaaatgttctgagtatt
tgctctgatgatgaactaatgactgaaggtgaagaccagtttgatggttcagctgcagcc
cggaaagaaatcataagaaacaaaattcgagcaattggcaagatggcaagggtcttctct
gttctcagggaggagagtgaaagcgtgctgacactcaagggcctgactcccacagggatg
ttgcctagtggagtgttggctggaggacggcagaccctgcaaagtgccacagttgaggct
attgaggctgaaaaagcaatacgaggattctctccaccacatagaatctgcagttttgaa
gaggcaaagggtttggataggatcaatgagagaatgccaccccggaaagatgctgtacag
caagatggtttcaattctctgaacaccgcacatgccactgagaaccacgggactggcaac
catagtgcccagtga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101368686
Entry
101368686         CDS       T05148                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04020  Calcium signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04114  Oocyte meiosis
oro04218  Cellular senescence
oro04310  Wnt signaling pathway
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04625  C-type lectin receptor signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04720  Long-term potentiation
oro04724  Glutamatergic synapse
oro04921  Oxytocin signaling pathway
oro04922  Glucagon signaling pathway
oro04924  Renin secretion
oro05010  Alzheimer disease
oro05014  Amyotrophic lateral sclerosis
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05031  Amphetamine addiction
oro05152  Tuberculosis
oro05163  Human cytomegalovirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05170  Human immunodeficiency virus 1 infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101368686 (PPP3R2)
   04310 Wnt signaling pathway
    101368686 (PPP3R2)
   04370 VEGF signaling pathway
    101368686 (PPP3R2)
   04020 Calcium signaling pathway
    101368686 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    101368686 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101368686 (PPP3R2)
   04218 Cellular senescence
    101368686 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101368686 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    101368686 (PPP3R2)
   04660 T cell receptor signaling pathway
    101368686 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    101368686 (PPP3R2)
   04659 Th17 cell differentiation
    101368686 (PPP3R2)
   04662 B cell receptor signaling pathway
    101368686 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101368686 (PPP3R2)
   04921 Oxytocin signaling pathway
    101368686 (PPP3R2)
   04924 Renin secretion
    101368686 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    101368686 (PPP3R2)
   04720 Long-term potentiation
    101368686 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    101368686 (PPP3R2)
   04380 Osteoclast differentiation
    101368686 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101368686 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101368686 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    101368686 (PPP3R2)
   05020 Prion disease
    101368686 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    101368686 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    101368686 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101368686 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101368686 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    101368686 (PPP3R2)
   05163 Human cytomegalovirus infection
    101368686 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101368686 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101368686 (PPP3R2)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101368686 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 101368686
NCBI-ProteinID: XP_004414343
UniProt: A0A2U3WXX7
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPEEVCSHFNPDEIKRLGKRFKKLDLDCSGSLSVEEFMSLPELQQNPLVRRVID
IFDTDGNGEVDFREFILGASQFSVRGDEEQKLKFAFSIYDIDKDGYISNGELFQVLKLMV
GNNLKDWQLQQLVDKTIIILDQDGDGKISFEEFSAAVGGLEVHKKLVVIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaagccagttacccggaagaggtgtgctcccacttcaaccccgatgaaatt
aaaaggctaggcaagaggtttaagaagctggacttggactgttcgggctctctgagtgtg
gaagagttcatgtccctgcccgagctgcagcagaacccgttggtgcggcgagtgatcgac
atcttcgacaccgacggcaacggagaagtggacttcagggagttcatcctgggagcctcc
cagttcagcgtcaggggggacgaggagcagaagttgaagttcgccttcagcatctacgac
attgataaagacggctacatttccaacggggagctcttccaggtgttgaagctgatggtg
ggcaacaacctgaaggactggcagttacagcagctcgtggacaaaaccatcatcatcctg
gatcaggatggagacgggaaaatatccttcgaggaattcagcgctgcggtcggaggcctg
gaggtccacaagaaattggtggtgattgtgtga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101385000
Entry
101385000         CDS       T05148                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X2
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04020  Calcium signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04114  Oocyte meiosis
oro04218  Cellular senescence
oro04310  Wnt signaling pathway
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04625  C-type lectin receptor signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04720  Long-term potentiation
oro04724  Glutamatergic synapse
oro04728  Dopaminergic synapse
oro04921  Oxytocin signaling pathway
oro04922  Glucagon signaling pathway
oro04924  Renin secretion
oro05010  Alzheimer disease
oro05014  Amyotrophic lateral sclerosis
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05031  Amphetamine addiction
oro05152  Tuberculosis
oro05163  Human cytomegalovirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05170  Human immunodeficiency virus 1 infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101385000 (PPP3CC)
   04310 Wnt signaling pathway
    101385000 (PPP3CC)
   04370 VEGF signaling pathway
    101385000 (PPP3CC)
   04020 Calcium signaling pathway
    101385000 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    101385000 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101385000 (PPP3CC)
   04218 Cellular senescence
    101385000 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101385000 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    101385000 (PPP3CC)
   04660 T cell receptor signaling pathway
    101385000 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    101385000 (PPP3CC)
   04659 Th17 cell differentiation
    101385000 (PPP3CC)
   04662 B cell receptor signaling pathway
    101385000 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101385000 (PPP3CC)
   04921 Oxytocin signaling pathway
    101385000 (PPP3CC)
   04924 Renin secretion
    101385000 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    101385000 (PPP3CC)
   04728 Dopaminergic synapse
    101385000 (PPP3CC)
   04720 Long-term potentiation
    101385000 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    101385000 (PPP3CC)
   04380 Osteoclast differentiation
    101385000 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101385000 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101385000 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    101385000 (PPP3CC)
   05020 Prion disease
    101385000 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    101385000 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    101385000 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101385000 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101385000 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    101385000 (PPP3CC)
   05163 Human cytomegalovirus infection
    101385000 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101385000 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101385000 (PPP3CC)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101385000 (PPP3CC)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     101385000 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 101385000
NCBI-ProteinID: XP_004402256
UniProt: A0A2U3W2R1
LinkDB
Position
Unknown
AA seq 525 aa
MSGRNLHLSTTERVIKAVPFPPTQRLTLKEVFENGKPKIDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLFLWSLKINHPKTVFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIKKLDRFKEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISDDEIEGGTTVRKEIIKNKIRAIGKMARVFSILREESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHRIRSFEEARGLDRINERMPPR
KDSQYPDGPVKFVAPVQPNTVHRSDRGRRASNDAEPCCGTGGSKT
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgtccgggaggaacctccacctctccaccaccgaacgcgtcatcaaagctgttcccttt
cctccaacccaacggcttactttgaaggaagtatttgagaatgggaaacctaaaattgat
gttttgaaaaaccatttagtgaaggaagggcgactggaagaggaagtagccttaaagata
atcaatgatggggctgccatcctgagacaagagaagaccatgatagaagtagatgctcca
atcacagtgtgtggtgacattcatggacaattctttgacttgatgaagttgtttgaagtt
ggaggatcacctagtaacacacgctacctctttctgggtgattatgtggacagaggctat
ttcagtatagagtgtgtgctgtttttatggagtttaaagattaatcatcccaaaacagtg
tttctgcttcgaggaaatcatgaatgcagacatcttacagaatatttcaccttcaaacag
gaatgtcgaatcaaatattctgaacaggtgtatgatgcgtgtatggagacatttgactgt
cttcctcttgctgccctcttaaaccagcagtttctgtgtgtacatggagggatgtcacct
gaaattactagtttagatgacattaagaaattagacaggtttaaagaacctccagccttt
gggccagtgtgtgacctgctttggtctgatccttcagaggattatggtaatgaaaagacc
ttggagcactatacccacaacactgtccgagggtgctcttatttttacagttaccctgca
gtttgtgaatttttgcagaacaataatttgttatcaataatcagagcccacgaagcccag
gatgctgggtatcgaatgtacaggaagagccaaacaacaggctttccatcactcattaca
attttctctgcccccaattacctagatgtctataataataaagctgctgtgctaaaatat
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccctactggcttcca
aactttatggacgttttcacatggtctttgccatttgttggggaaaaagtcacagagatg
ctggttaacattctcaacatatgctctgatgatgaattgatttctgatgatgaaattgaa
ggaggcactacagttcgaaaggagatcatcaagaataaaatcagagccattgggaagatg
gcacgggtcttttcaattctgcgggaagagagtgagagtgtgctgactctcaagggcctg
actccaacagggacactccctctaggtgtcctctcgggaggaaagcagactattgagaca
gccacagtagaagcggtagaggcccgggaagccatcagagggttttcgcttcagcacagg
atccggagttttgaagaagcccgaggtctggaccgaattaacgaacggatgccaccccga
aaagacagccagtaccccgatgggccagtgaaatttgtggcccctgtacaacccaacact
gtgcacaggagcgacagggggagaagagccagtaatgacgcagagccctgctgtggcaca
ggtggatccaaaacttaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101386271
Entry
101386271         CDS       T05148                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1 isoform X1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04020  Calcium signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04114  Oocyte meiosis
oro04218  Cellular senescence
oro04310  Wnt signaling pathway
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04625  C-type lectin receptor signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04720  Long-term potentiation
oro04724  Glutamatergic synapse
oro04921  Oxytocin signaling pathway
oro04922  Glucagon signaling pathway
oro04924  Renin secretion
oro05010  Alzheimer disease
oro05014  Amyotrophic lateral sclerosis
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05031  Amphetamine addiction
oro05152  Tuberculosis
oro05163  Human cytomegalovirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05170  Human immunodeficiency virus 1 infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101386271 (PPP3R1)
   04310 Wnt signaling pathway
    101386271 (PPP3R1)
   04370 VEGF signaling pathway
    101386271 (PPP3R1)
   04020 Calcium signaling pathway
    101386271 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    101386271 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101386271 (PPP3R1)
   04218 Cellular senescence
    101386271 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101386271 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    101386271 (PPP3R1)
   04660 T cell receptor signaling pathway
    101386271 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    101386271 (PPP3R1)
   04659 Th17 cell differentiation
    101386271 (PPP3R1)
   04662 B cell receptor signaling pathway
    101386271 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101386271 (PPP3R1)
   04921 Oxytocin signaling pathway
    101386271 (PPP3R1)
   04924 Renin secretion
    101386271 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101386271 (PPP3R1)
   04720 Long-term potentiation
    101386271 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    101386271 (PPP3R1)
   04380 Osteoclast differentiation
    101386271 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101386271 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101386271 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    101386271 (PPP3R1)
   05020 Prion disease
    101386271 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    101386271 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    101386271 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101386271 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101386271 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    101386271 (PPP3R1)
   05163 Human cytomegalovirus infection
    101386271 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101386271 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101386271 (PPP3R1)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101386271 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 101386271
NCBI-ProteinID: XP_004397556
UniProt: A0A2U3VR26
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt
aaaaggctaggaaagagatttaagaagctcgacttggacaattcgggctctttgagtgtg
gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat
atatttgacacagatgggaatggagaagtagactttaaagaattcattgagggagtctct
cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac
atggataaagatggatatatttccaatggggaactgttccaggtgctgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaatcgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system