KEGG   Odobenus rosmarus divergens (Pacific walrus): 101363195
Entry
101363195         CDS       T05148                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04390  Hippo signaling pathway
oro04810  Regulation of actin cytoskeleton
oro05200  Pathways in cancer
oro05218  Melanoma
oro05224  Breast cancer
oro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101363195 (FGF1)
   04014 Ras signaling pathway
    101363195 (FGF1)
   04015 Rap1 signaling pathway
    101363195 (FGF1)
   04390 Hippo signaling pathway
    101363195 (FGF1)
   04151 PI3K-Akt signaling pathway
    101363195 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101363195 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101363195 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101363195 (FGF1)
   05218 Melanoma
    101363195 (FGF1)
   05224 Breast cancer
    101363195 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101363195 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:oro00536]
    101363195 (FGF1)
Cytokines and growth factors [BR:oro04052]
 Growth factors
  Growth factors (RTK binding)
   101363195 (FGF1)
Glycosaminoglycan binding proteins [BR:oro00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101363195 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101363195
NCBI-ProteinID: XP_004397790
UniProt: A0A2U3VRM8
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALMEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcacaaccttcaccgccctgatggagaagtttaatctgcctccg
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggacgggacaagagacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgatgggcttttgtacggctcacagacaccaaatgaggaatgtttgttc
ttggaaaggctggaggaaaaccattacaacacctacacctccaagaagcacgccgaaaag
aattggtttgttggtctcaaaaagaacggaagctgcaaacgtggtcctcggactcactat
ggccagaaggcaattctgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system