KEGG   Odobenus rosmarus divergens (Pacific walrus): 101363544
Entry
101363544         CDS       T05148                                 

Gene name
THPO
Definition
(RefSeq) LOW QUALITY PROTEIN: thrombopoietin
  KO
K06854  thrombopoietin
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101363544 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101363544 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101363544 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101363544 (THPO)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  CSF and other factors
   101363544 (THPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 101363544
NCBI-ProteinID: XP_012420094
UniProt: A0A2U3ZM69
LinkDB
Position
Unknown
AA seq 276 aa
MLLLTARLDLCLPAPPACDPRLLNKLLRDSHVLHSRLNQCPDVNPLSTPVLLPAVDFSLG
EWKTQKEKTKAQDVLGAATLLLEGVMAARRQLGPTCLSSLLGQLSGQVRLLLGALQGLLG
TQLPPQGRTTTHKDPNAIFLTFQQLLRGKDFWIVGDKLQCLSQNYWLWTSEEAAGIQSQD
SWSAEPNLQVPRPNAWTPEQDTRTLDWNSWTLSWTLTRGPRSPRHPSGNFRHGLPAPQPL
AWICSFPNPSSCWAIHTLLSFTHLAHPPGPAPTSIS
NT seq 831 nt   +upstreamnt  +downstreamnt
atgcttctcctaactgcaagactggatctgtgcctcccggctccccccgcctgtgacccc
cgtctcctaaataaactgcttcgcgactcccatgtccttcacagcagactgaaccagtgt
ccagacgttaaccctttgtccacacctgtcctgctgcctgctgtggacttcagcttggga
gaatggaaaacccagaaggagaagaccaaggcacaggacgttctgggagccgcgaccctt
ctgctggagggagtaatggcagcacggagacaactgggacccacctgcctctcatccctc
ctgggacagctttctggacaggtccgtctcctccttggggccctgcagggcctccttgga
acccagcttcctccacagggcaggaccacaactcacaaggatcccaatgccatattcctg
accttccaacaactgctccgaggaaaggacttctggattgttggagacaaactccagtgt
ctcagccagaactactggctctggacttctgaagaggctgcagggattcagagccaagat
tcctggtctgctgaaccaaacctccaggtccctagaccaaatgcctggacacctgaacag
gacacacggacccttgattggaactcatggactctttcctggaccctcacccgtggccct
aggagccccagacatccctccgggaacttcagacatggactccctgccccccaacctctg
gcctggatatgctccttccccaacccatcctcctgctgggcaatacacactcttctctcc
ttcacccacctcgcccacccccccgggccagctccaacctccatctcctga

DBGET integrated database retrieval system