KEGG   Odobenus rosmarus divergens (Pacific walrus): 101363592
Entry
101363592         CDS       T05148                                 

Gene name
HSP90AA1
Definition
(RefSeq) LOW QUALITY PROTEIN: heat shock protein HSP 90-alpha
  KO
K04079  molecular chaperone HtpG
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04141  Protein processing in endoplasmic reticulum
oro04151  PI3K-Akt signaling pathway
oro04217  Necroptosis
oro04612  Antigen processing and presentation
oro04621  NOD-like receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04659  Th17 cell differentiation
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro05132  Salmonella infection
oro05200  Pathways in cancer
oro05215  Prostate cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101363592 (HSP90AA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101363592 (HSP90AA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101363592 (HSP90AA1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101363592 (HSP90AA1)
   04612 Antigen processing and presentation
    101363592 (HSP90AA1)
   04659 Th17 cell differentiation
    101363592 (HSP90AA1)
   04657 IL-17 signaling pathway
    101363592 (HSP90AA1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101363592 (HSP90AA1)
   04914 Progesterone-mediated oocyte maturation
    101363592 (HSP90AA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101363592 (HSP90AA1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101363592 (HSP90AA1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101363592 (HSP90AA1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101363592 (HSP90AA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101363592 (HSP90AA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:oro03110]
    101363592 (HSP90AA1)
   04131 Membrane trafficking [BR:oro04131]
    101363592 (HSP90AA1)
   03051 Proteasome [BR:oro03051]
    101363592 (HSP90AA1)
   03029 Mitochondrial biogenesis [BR:oro03029]
    101363592 (HSP90AA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101363592 (HSP90AA1)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101363592 (HSP90AA1)
Chaperones and folding catalysts [BR:oro03110]
 Heat shock proteins
  HSP90
   101363592 (HSP90AA1)
Membrane trafficking [BR:oro04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101363592 (HSP90AA1)
Proteasome [BR:oro03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101363592 (HSP90AA1)
Mitochondrial biogenesis [BR:oro03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    101363592 (HSP90AA1)
Exosome [BR:oro04147]
 Exosomal proteins
  Proteins found in most exosomes
   101363592 (HSP90AA1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 101363592
NCBI-ProteinID: XP_004417896
UniProt: A0A2U3X609
LinkDB
Position
Unknown
AA seq 682 aa
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGEPMGRGTKVILHLKEDQTEYLEERRIKEIVXXXXXXXDVSITLFVEKE
RDKEVSDDEADEKDEKGEGGGEDEKGPGDKPEIEDVGSEEEEEEKRDADRKRRKKIKEKY
VDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVP
RRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPRRSTPSLSA
IPLLXFVSVRLGRGSXKWWPELGDKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSAS
GDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCV
QQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSN
RLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGSMAAKKHLEINPDHSIIETLRQKA
EADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDSSA
AVSEEMPPLEGDDDTSRMEEVD
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgcctgaggaaacccagacccaagaccagccgatggaggaggaggaggtggagacgttc
gccttccaggcggagatcgcccagttgatgtccctgatcatcaacactttctactcgaat
aaggagatctttctcagggagctgatttccaactcgtcggacgctttggacaaaatcaga
tacgagagcttgaccgatcccagtaagctagactctgggaaagagctgcacattaacctc
attccgaacaagcaagatcgaaccctcaccatcgtggataccggcattggcatgaccaag
gccgatttgatcaataaccttggtactatcgccaagtctgggaccaaagcattcatggaa
gctttgcaggctggtgcagacatttctatgattggtgaacctatgggtcggggaacaaag
gttatcctgcatctgaaagaagaccagacagagtacttggaggaaaggagaataaaagag
attgtgnnnnnnnnnnnnnnnnnnnaagacgttagtattactctgtttgtggagaaggag
cgcgacaaggaggtcagtgacgacgaggcggacgagaaggacgagaagggggagggagga
ggagaggacgagaaggggcccggtgacaagcctgagatcgaagacgtcggctcggaggag
gaggaggaggagaagagggacgcggacaggaagcggagaaagaagatcaaggagaagtac
gtcgaccaggaggagctgaacaaaacgaagcccatctggaccagaaaccccgacgacatc
accaacgaggaatacggagagttttacaagagcttgaccaacgactgggaagatcacctg
gcagtgaagcatttttcagtggaaggacagttggagttcagagctcttctctttgtgcca
agacgcgctccctttgacctcttcgagaacagaaagaaaaagaacaacatcaagttgtac
gttcgcagggtgttcatcatggacaactgcgaggagctaatccccgagtatctgaatttc
attagaggtgtggtggactctgaggatcttcctcgaagaagcactcccagtttatcggct
atcccattactcntgtttgtgagtgtccgcctggggcgtgggtcctagaagtggtggcct
gagctgggggacaagaagttttatgagcagttttcgaaaaacatcaagctgggaatacat
gaagactctcagaatcgaaagaagctctccgagctgttacgatactacacgtctgcttct
ggcgatgagatggtttccctcaaggactattgcaccagaatgaaggaaaaccagaaacac
atctattacatcacaggtgagaccaaggatcaggtagcaaactcagccttcgtggagcgt
cttcggaagcatggtttggaagtgatctatatgattgagcccatcgatgagtactgtgtc
caacagctgaaggaatttgaggggaagacgttagtgtctgttaccaaagagggcttggaa
cttccagaagacgaagaagagaaaaagaaacaggaagagaaaaaaacaaagtttgaaaac
ctgtgcaagatcatgaaggacatcttggagaaaaaagtagaaaaggtggtcgtgtcaaac
cgattggtgacctctccgtgctgcattgtcacaagcacatacggctggacggcaaacatg
gagaggatcatgaaggcccaggccttgagagacaactccaccatgggctccatggccgcg
aagaagcacctggagataaaccccgaccactccatcattgagaccttacggcagaaggca
gaggccgacaagaatgacaagtctgtgaaagatctggtcatcctgctttacgaaaccgct
ctcctgtcctctggcttcagtctggaagatccccagacacatgctaaccggatctacagg
atgatcaagctcgggctcggtattgacgaagacgaccccacggctgacgacagcagtgcc
gcggtgagcgaagagatgccgccccttgagggcgacgatgacacgtcccgcatggaggaa
gtcgattaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101365532
Entry
101365532         CDS       T05148                                 

Gene name
HSP90AB1
Definition
(RefSeq) heat shock protein HSP 90-beta isoform X1
  KO
K04079  molecular chaperone HtpG
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04141  Protein processing in endoplasmic reticulum
oro04151  PI3K-Akt signaling pathway
oro04217  Necroptosis
oro04612  Antigen processing and presentation
oro04621  NOD-like receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04659  Th17 cell differentiation
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro05132  Salmonella infection
oro05200  Pathways in cancer
oro05215  Prostate cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101365532 (HSP90AB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101365532 (HSP90AB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101365532 (HSP90AB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101365532 (HSP90AB1)
   04612 Antigen processing and presentation
    101365532 (HSP90AB1)
   04659 Th17 cell differentiation
    101365532 (HSP90AB1)
   04657 IL-17 signaling pathway
    101365532 (HSP90AB1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101365532 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    101365532 (HSP90AB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101365532 (HSP90AB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101365532 (HSP90AB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101365532 (HSP90AB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101365532 (HSP90AB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101365532 (HSP90AB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:oro03110]
    101365532 (HSP90AB1)
   04131 Membrane trafficking [BR:oro04131]
    101365532 (HSP90AB1)
   03051 Proteasome [BR:oro03051]
    101365532 (HSP90AB1)
   03029 Mitochondrial biogenesis [BR:oro03029]
    101365532 (HSP90AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101365532 (HSP90AB1)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101365532 (HSP90AB1)
Chaperones and folding catalysts [BR:oro03110]
 Heat shock proteins
  HSP90
   101365532 (HSP90AB1)
Membrane trafficking [BR:oro04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101365532 (HSP90AB1)
Proteasome [BR:oro03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101365532 (HSP90AB1)
Mitochondrial biogenesis [BR:oro03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    101365532 (HSP90AB1)
Exosome [BR:oro04147]
 Exosomal proteins
  Proteins found in most exosomes
   101365532 (HSP90AB1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 LOH1CR12
Other DBs
NCBI-GeneID: 101365532
NCBI-ProteinID: XP_004408188
UniProt: A0A2U3WHI4
LinkDB
Position
Unknown
AA seq 720 aa
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELSKTKPIWTDITQEEYGEF
YKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFIMD
SCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAEDKE
NYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIY
YITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELP
EDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMER
IMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALL
SSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRMEEVD
NT seq 2163 nt   +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacttttgccttccaggcagaa
attgcccaactcatgtccctcattatcaataccttctattctaacaaggaaattttcctt
cgggagttaatcagtaatgcttctgatgccttggacaagattcgctatgagagcctgaca
gacccttccaagttggacagtggtaaagagctgaaaattgacatcatccccaacccccag
gaacgcaccctgactctagtggacacaggcattggcatgaccaaagccgatctcataaat
aatttgggaaccattgccaagtccggaactaaagcattcatggaggctcttcaggctggt
gcagacatctccatgatcggacagtttggcgttggcttttattctgcctacctggtggca
gagaaggtggtggttatcacaaagcacaatgatgatgagcagtatgcctgggagtcttct
gctgggggctccttcactgtacgtgcagaccatggtgagcccattggccggggtactaaa
gtgattctccatcttaaagaagaccagacagagtatttagaggagagacgtgtcaaagaa
gttgtgaagaagcattcgcagttcataggttatcccatcaccctttatttggagaaggaa
cgagagaaagaaatcagtgatgatgaggcagaggaggagaaaggggagaaagaggaagaa
gataaagatgatgaggagaagcccaagattgaagatgtgggttcagatgaggaggatgat
agtgggaaggacaagaaaaagaaaacaaagaagattaaggagaaatacatagatcaggaa
gaactgagcaagaccaagcccatttggaccgacattacccaggaggaatatggagagttt
tacaagagtcttactaatgactgggaagaccacttggcagtcaagcatttctctgtagaa
ggtcagctggaattcagggcattgctgtttatcccccgtcgggccccttttgatctcttt
gagaacaagaagaaaaagaacaacatcaaactctacgttcgccgtgtgttcatcatggac
agctgtgatgaattgataccagagtatctcaacttcatccgtggtgtggttgattccgag
gacctgcccttgaatatctcccgagaaatgctccagcagagcaaaattttgaaggtcatt
cgcaaaaatattgtgaagaagtgccttgagctcttctctgaattggcagaagacaaggag
aactataagaaattctatgaggcgttctctaaaaacctaaagcttggaatccatgaggac
tctactaaccggcgccgcctttctgagctgctgcgttaccacacttcccagtctggggat
gagatgacttctctttcagaatatgtgtcccgcatgaaagagacccagaagtccatctat
tatatcactggtgagagcaaggagcaggttgccaactccgcttttgtggagcgagtgcgg
aagcggggcttcgaggtagtgtatatgacggagcctatcgatgagtactgcgtgcagcag
ctcaaggagtttgatgggaagagtctagtctcggttaccaaggagggcctggagctgcct
gaagatgaagaggagaagaagaaaatggaggagagcaaggccaagtttgagaacctttgc
aaactcatgaaagaaatcttggataagaaggttgagaaggtgacaatctccaacaggcta
gtgtcttcaccctgctgcattgtgactagcacctatggctggacggccaacatggagcgg
atcatgaaagcccaggcccttcgggacaactctacgatgggctatatgatggccaagaag
cacctggagatcaaccctgaccaccccatcgtggaaacgctgcggcagaaggccgaggcg
gacaagaatgacaaggcggtcaaggacctggtggtgctgctgtttgaaacagctctgctt
tcctctggcttctcacttgaggatccccagactcattccaaccgcatctaccgcatgatc
aagctaggcctgggcattgatgaagatgaagtgaccgcagaggaacccagtgctgctgtt
cctgatgagatccccccccttgagggtgatgaggatgcctctcgcatggaagaagtagat
tag

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101381301
Entry
101381301         CDS       T05148                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: heat shock protein HSP 90-alpha-like
  KO
K04079  molecular chaperone HtpG
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04141  Protein processing in endoplasmic reticulum
oro04151  PI3K-Akt signaling pathway
oro04217  Necroptosis
oro04612  Antigen processing and presentation
oro04621  NOD-like receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04659  Th17 cell differentiation
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro05132  Salmonella infection
oro05200  Pathways in cancer
oro05215  Prostate cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101381301
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101381301
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101381301
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101381301
   04612 Antigen processing and presentation
    101381301
   04659 Th17 cell differentiation
    101381301
   04657 IL-17 signaling pathway
    101381301
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101381301
   04914 Progesterone-mediated oocyte maturation
    101381301
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101381301
  09162 Cancer: specific types
   05215 Prostate cancer
    101381301
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101381301
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101381301
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101381301
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:oro03110]
    101381301
   04131 Membrane trafficking [BR:oro04131]
    101381301
   03051 Proteasome [BR:oro03051]
    101381301
   03029 Mitochondrial biogenesis [BR:oro03029]
    101381301
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101381301
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101381301
Chaperones and folding catalysts [BR:oro03110]
 Heat shock proteins
  HSP90
   101381301
Membrane trafficking [BR:oro04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101381301
Proteasome [BR:oro03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101381301
Mitochondrial biogenesis [BR:oro03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    101381301
Exosome [BR:oro04147]
 Exosomal proteins
  Proteins found in most exosomes
   101381301
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 LOH1CR12
Other DBs
NCBI-GeneID: 101381301
NCBI-ProteinID: XP_012420874
UniProt: A0A2U3ZPF9
LinkDB
Position
Unknown
AA seq 732 aa
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEILLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGTGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGHFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSLTVRTDTGEPM
GRGTKVILHLKEDXEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEADEKDEK
GEGGEEDEKGPGDKPEIEDIGSEEEEEEKRDTDRKRRKKIKEKYIDQEELNKTKPIWTRN
PDDITNEEYGEFYKSWTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKELSELLRYYTSASGDEMVSLKDY
CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEMIYMIEPIDEYCVQQLKEFEGKT
LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
TSTYGWTANMERIMKAQALRDNSTTGSMAAKKHLEINPDHSIIETLQQKAEPDKNDKSVK
DLVFLLYETALLSSGSSLEDPQTHANRIYRMIKLGLGIDEDDPTADDSSAAVSEEMPPLE
GDDDTSRMEEVD
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgcctgaggaaacccagacccaagaccagccgatggaggaggaggaggtggagacgttc
gccttccaggcggagatcgcccagttgatgtccctgatcatcaacaccttctactcgaat
aaggagatccttctcagggagctgatttccaactcgtcggacgctttggacaaaatcaga
tacgagagcttgactgatcccagtaagctagactctgggaaagagctgcacattaacctc
attccgaacaagcaagatcgaaccctcaccatcgtggataccggcactggcatgaccaag
gccgatttgatcaataaccttggtactatcgccaagtctgggaccaaagcattcatggaa
gctttgcaggctggtgcagacatttctatgattggccattttggtgttgggttctattct
gcctacttggttgccgagaaagtgacggtgatcaccaagcataacgatgatgagcagtat
gcctgggagtcttctgcaggaggatcgctcacagttaggacagatacaggtgaacctatg
ggtcggggaacaaaggttatcctgcatctgaaagaagacncagagtacttggaggaaagg
agaataaaagagattgtgaagaagcactcccagtttatcggctatcccattactctgttt
gtggagaaggagcgcgacaaggaggtcagtgacgacgaggcggacgagaaggacgagaaa
ggggagggaggagaagaggacgagaaggggcccggtgacaagcctgagatcgaagacatc
ggctcagaggaggaggaggaggagaagagggacacggacaggaagaggagaaagaagatc
aaggagaaatacatcgaccaggaagaactgaacaaaacgaagcccatttggaccagaaac
cctgacgacatcaccaacgaggaatatggagagttttacaagagctggaccaacgactgg
gaagatcacctggcagtgaagcatttttcagtggaaggacagttggagttcagagctctt
ctctttgtgccaagacgcgctccctttgacctcttcgagaacagaaagaaaaagaacaac
attaagttgtatgttcgcagagttttcatcatggataactgcgaggagctaattcccgag
tatctgaatttcattagaggtgtggtggactctgaggatcttcctctaaatatttcccgt
gagatgcttcagcaaagcaaaattttaaaagttatcagaaagaacttggtcaaaaagtgc
ttggaactcttcaccgaactggctgaagacaaagagaactacaagaagttttatgagcag
ttttcaaaaaacatcaagctgggaatacatgaagactctcagaatcgaaaggagctctcc
gagctgttacgatactacacgtctgcttctggcgatgagatggtttccctcaaggactat
tgcaccagaatgaaggaaaaccagaaacacatctattacatcacaggtgagaccaaggat
caggtagcaaactcagccttcgtggagcgtcttcggaagcatggtttggaaatgatctat
atgattgagcccatcgatgagtactgtgtccaacagctgaaggaatttgaggggaagacg
ttagtgtctgttaccaaagagggcttggaacttccagaagacgaagaagagaaaaagaaa
caggaagagaaaaaaacaaagtttgaaaacctgtgcaagatcatgaaggacatcttggag
aaaaaagtagaaaaggtggttgtgtcaaaccgattggtgacctctccgtgctgcattgtc
acaagcacatacggctggacggcaaacatggagaggatcatgaaggcccaggccttgaga
gacaactccaccacgggctccatggccgcgaagaagcacctggagataaaccccgaccac
tccatcattgagaccttacagcagaaggcagagcccgacaagaatgacaagtctgtgaaa
gatctggtcttcctgctttacgaaacagctctcctgtcgtctggctccagtctggaagat
ccccagacacatgctaaccggatctacaggatgatcaagctcgggctcggtattgacgaa
gacgaccccacggctgacgacagcagtgccgcggtgagcgaagagatgccgccccttgag
ggcgacgatgacacgtcccgcatggaggaagtcgattaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101384762
Entry
101384762         CDS       T05148                                 

Gene name
HSP90B1
Definition
(RefSeq) endoplasmin isoform X1
  KO
K09487  heat shock protein 90kDa beta
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04141  Protein processing in endoplasmic reticulum
oro04151  PI3K-Akt signaling pathway
oro04657  IL-17 signaling pathway
oro04915  Estrogen signaling pathway
oro04918  Thyroid hormone synthesis
oro05132  Salmonella infection
oro05200  Pathways in cancer
oro05215  Prostate cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101384762 (HSP90B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101384762 (HSP90B1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101384762 (HSP90B1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101384762 (HSP90B1)
   04918 Thyroid hormone synthesis
    101384762 (HSP90B1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101384762 (HSP90B1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101384762 (HSP90B1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101384762 (HSP90B1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101384762 (HSP90B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:oro03110]
    101384762 (HSP90B1)
Chaperones and folding catalysts [BR:oro03110]
 Heat shock proteins
  HSP90
   101384762 (HSP90B1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF4518
Other DBs
NCBI-GeneID: 101384762
NCBI-ProteinID: XP_004414318
UniProt: A0A2U3WXK3
LinkDB
Position
Unknown
AA seq 804 aa
MRALWVLGLCCVLLTFGSVRADNEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAK
EEKEDSDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEDDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPSDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIKDMLRRVKEDEDDKTVSDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETTEDTTEDTEQDEEE
EMDAGTDEEEQESVKKSTGEKDEL
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgagggccctgtgggtgcttggcctctgctgcgtcctgctgaccttcgggtcggtccga
gctgacaatgaagtcgatgtggatggtaccgtggaagaggatctaggcaaaagtagagaa
ggctcaaggacagatgacgaagtagtgcagagagaggaagaagctattcagttggatgga
ttaaatgcatcccaaataagagaacttagagagaaatcagaaaaatttgccttccaagct
gaagttaatagaatgatgaaacttatcatcaattcattgtataaaaataaagagattttc
ttgagagaactgatttcaaatgcttctgacgctttagataagataaggttaatatcattg
actgatgaaaatgctcttgctggaaatgaggaactaactgtcaaaattaagtgtgacaag
gagaagaatctgctacatgtcacagatactggtgtaggaatgacccgggaagagttggtt
aaaaaccttggtaccatagccaaatctggaacaagcgagtttttaaacaaaatgactgag
gcacaagaagatggccagtcaacttctgaattgattggccagtttggtgtcggtttctat
tctgccttccttgtagcagataaggttattgtcacatcaaaacacaacaacgatacccag
cacatctgggaatctgactccaatgaattttctgtaattgctgacccaagaggaaacact
ctaggacggggaacaaccattacactcgttttaaaagaagaagcatctgattaccttgaa
ttggacacaattaaaaatctcgtcaagaaatattcacagtttataaacttccctatttat
gtgtggagcagcaagactgaaactgttgaggagcccatggaggaagaagaagcagcaaaa
gaagaaaaagaagattctgatgatgaagctgcagtggaagaagaagaagaggaaaaaaaa
ccgaaaaccaaaaaagttgaaaaaactgtctgggattgggaacttatgaatgacatcaaa
ccgatatggcagagaccatcaaaagaagtagaagatgatgaatacaaagctttctacaaa
tcattttcaaaggaaagtgatgaccccatggcttatatccactttactgctgaaggggaa
gttaccttcaaatcaattttattcgtacctacatctgctccacgtggtctgtttgacgaa
tatggatctaagaagagtgattacattaagctatatgtgcgccgagtattcatcacagat
gacttccatgatatgatgcccaagtaccttaattttgtcaagggtgttgtggactcagat
gatctccccttgaatgtttcccgggaaactcttcagcagcataaactgcttaaggtgatt
agaaagaagcttgtccgtaaaactctggacatgattaagaagattgctgatgagaagtac
aatgatactttttggaaagaatttggtaccaacatcaagcttggtgtgattgaagaccac
tcaaatcgaacacgtcttgctaaacttcttagattccagtcttctcatcatccaagtgac
attaccagtctagaccagtatgtggaaagaatgaaggaaaaacaagacaaaatctacttc
atggctgggtccagcagaaaagaggctgaatcttctccatttgtggagcgacttctgaaa
aagggctatgaagtgatttatctcacagaacctgtggacgaatattgcattcaggctctt
cctgagtttgatggcaaaaggttccagaatgttgccaaagaaggtgtgaaatttgatgaa
agtgagaaaacgaaggagagccgtgaagcagttgagaaagaatttgagcctctgctcaac
tggatgaaagataaagctctcaaggacaagattgaaaaggctgtggtatctcagcgtctg
acagagtccccatgtgctcttgtggccagccagtacggatggtctggcaacatggagaga
atcatgaaagctcaagcataccaaacgggcaaagacatctctacaaattactatgccagc
cagaagaaaacatttgaaattaatcccagacatcccctgatcaaagacatgcttcgacgg
gttaaggaagatgaagatgacaaaactgtttcagatcttgctgtggttttgtttgaaaca
gcaacactgcggtcaggatatctgttaccagacactaaagcatatggagatcgaatagaa
agaatgcttcgcctcagtttaaacattgaccctgacgcaaaggtggaagaagaacccgaa
gaagaacctgaagaaacaacagaggacaccacagaagacacagagcaagatgaagaagaa
gaaatggatgcaggaacagacgaagaagaacaagaatcagtaaagaaatctacaggtgaa
aaagatgaattataa

DBGET integrated database retrieval system