KEGG   Odobenus rosmarus divergens (Pacific walrus): 101363732
Entry
101363732         CDS       T05148                                 

Gene name
RHEB
Definition
(RefSeq) GTP-binding protein Rheb isoform X1
  KO
K07208  Ras homolog enriched in brain
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04072  Phospholipase D signaling pathway
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04211  Longevity regulating pathway
oro04218  Cellular senescence
oro04714  Thermogenesis
oro04910  Insulin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05168  Herpes simplex virus 1 infection
oro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    101363732 (RHEB)
   04151 PI3K-Akt signaling pathway
    101363732 (RHEB)
   04152 AMPK signaling pathway
    101363732 (RHEB)
   04150 mTOR signaling pathway
    101363732 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101363732 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    101363732 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101363732 (RHEB)
   04919 Thyroid hormone signaling pathway
    101363732 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    101363732 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    101363732 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101363732 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101363732 (RHEB)
   05163 Human cytomegalovirus infection
    101363732 (RHEB)
   05165 Human papillomavirus infection
    101363732 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:oro04031]
    101363732 (RHEB)
GTP-binding proteins [BR:oro04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    101363732 (RHEB)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB
Other DBs
NCBI-GeneID: 101363732
NCBI-ProteinID: XP_004408887
UniProt: A0A2U3WJ87
LinkDB
Position
Unknown
AA seq 184 aa
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS
CSVM
NT seq 555 nt   +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc
tcattgacgattcagtttgttgaaggccagtttgttgactcctacgacccaaccatagaa
aacactttcacaaaattgatcacagtcaatggacaagaatatcatcttcagcttgtcgac
accgcggggcaggatgaatactccatctttcctcagacatactccatagatattaatggt
tacattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttattcat
ggcaaattgttggatatggtggggaaagtgcaaatacctattatgttggttgggaataag
aaagacctccatatggaaagggtgatcagttatgaagaagggaaagcgttagcagagtct
tggaacgcggctttcttggaatcttctgctaaagaaaatcagacggctgttgacgttttt
agaaggataattttggaggcagaaaaaattgacggggccgcttcacaaggaaagtcgtcc
tgctcggtgatgtaa

DBGET integrated database retrieval system