KEGG   Odobenus rosmarus divergens (Pacific walrus): 101363844
Entry
101363844         CDS       T05148                                 

Gene name
MTOR
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro04012  ErbB signaling pathway
oro04066  HIF-1 signaling pathway
oro04072  Phospholipase D signaling pathway
oro04136  Autophagy - other
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04211  Longevity regulating pathway
oro04213  Longevity regulating pathway - multiple species
oro04218  Cellular senescence
oro04371  Apelin signaling pathway
oro04613  Neutrophil extracellular trap formation
oro04630  JAK-STAT signaling pathway
oro04659  Th17 cell differentiation
oro04714  Thermogenesis
oro04910  Insulin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04920  Adipocytokine signaling pathway
oro04930  Type II diabetes mellitus
oro04931  Insulin resistance
oro04935  Growth hormone synthesis, secretion and action
oro05010  Alzheimer disease
oro05014  Amyotrophic lateral sclerosis
oro05016  Huntington disease
oro05017  Spinocerebellar ataxia
oro05022  Pathways of neurodegeneration - multiple diseases
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05170  Human immunodeficiency virus 1 infection
oro05200  Pathways in cancer
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05212  Pancreatic cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05221  Acute myeloid leukemia
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101363844 (MTOR)
   04371 Apelin signaling pathway
    101363844 (MTOR)
   04630 JAK-STAT signaling pathway
    101363844 (MTOR)
   04066 HIF-1 signaling pathway
    101363844 (MTOR)
   04072 Phospholipase D signaling pathway
    101363844 (MTOR)
   04151 PI3K-Akt signaling pathway
    101363844 (MTOR)
   04152 AMPK signaling pathway
    101363844 (MTOR)
   04150 mTOR signaling pathway
    101363844 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101363844 (MTOR)
   04136 Autophagy - other
    101363844 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    101363844 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101363844 (MTOR)
   04659 Th17 cell differentiation
    101363844 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101363844 (MTOR)
   04920 Adipocytokine signaling pathway
    101363844 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    101363844 (MTOR)
   04919 Thyroid hormone signaling pathway
    101363844 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    101363844 (MTOR)
   04213 Longevity regulating pathway - multiple species
    101363844 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    101363844 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101363844 (MTOR)
   05206 MicroRNAs in cancer
    101363844 (MTOR)
   05205 Proteoglycans in cancer
    101363844 (MTOR)
   05230 Central carbon metabolism in cancer
    101363844 (MTOR)
   05231 Choline metabolism in cancer
    101363844 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101363844 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101363844 (MTOR)
   05212 Pancreatic cancer
    101363844 (MTOR)
   05225 Hepatocellular carcinoma
    101363844 (MTOR)
   05226 Gastric cancer
    101363844 (MTOR)
   05214 Glioma
    101363844 (MTOR)
   05221 Acute myeloid leukemia
    101363844 (MTOR)
   05215 Prostate cancer
    101363844 (MTOR)
   05224 Breast cancer
    101363844 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101363844 (MTOR)
   05014 Amyotrophic lateral sclerosis
    101363844 (MTOR)
   05016 Huntington disease
    101363844 (MTOR)
   05017 Spinocerebellar ataxia
    101363844 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    101363844 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101363844 (MTOR)
   04931 Insulin resistance
    101363844 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101363844 (MTOR)
   05168 Herpes simplex virus 1 infection
    101363844 (MTOR)
   05163 Human cytomegalovirus infection
    101363844 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101363844 (MTOR)
   05165 Human papillomavirus infection
    101363844 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101363844 (MTOR)
   01522 Endocrine resistance
    101363844 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101363844 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101363844 (MTOR)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101363844 (MTOR)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   101363844 (MTOR)
Membrane trafficking [BR:oro04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    101363844 (MTOR)
SSDB
Motif
Pfam: FAT DUF3385 PI3_PI4_kinase FRB_dom FATC HEAT_2 V-ATPase_H_N UME EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 101363844
NCBI-ProteinID: XP_004411199
UniProt: A0A2U3WPU6
LinkDB
Position
Unknown
AA seq 2559 aa
MLGTGPAATTTATTTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPPQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTALPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITSTTTAATTAATATATATSTEGSNSESEAESTENS
PTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDV
NEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVA
SKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYF
GERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQ
AWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPS
LQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKN
LSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLT
LMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDR
KPSSLENKXINKIQNKRKQSSHWTWFFSFISPQVAMTREKFPEKIPFRLTRMLTNAMEVT
GLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYS
AGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTG
RDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7680 nt   +upstreamnt  +downstreamnt
atgctcggaaccggacccgctgccaccaccacagctaccaccacatccagcaacgtgagc
gtcctgcagcagttcgccagtggcctgaagagccggaatgaggagaccagggccaaagct
gccaaggagctccagcactatgtcaccatggagcttcgagagatgagtcaggaggaatct
acgcgcttctatgatcagctgaaccatcacatctttgagctggtttctagctcagatgcc
aatgagagaaaaggtggcatcttggccatagccagcctcattggagtggaaggcgggaat
gccactcggattggcagattcgctaactatcttcggaacctcctcccctcgaatgaccca
gttgtcatggagatggcatccaaggccattggccgcctcgccatggcaggggacactttt
acagctgagtatgtggagtttgaggtgaagcgagccttggagtggctgggcgctgaccgc
aacgagggccggagacacgcagctgttctggttctccgtgagctggccatcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgggagggagctgtagctgcccttcgtgcctgtttgatcctcacc
acccagcgtgagccgaaggagatgcagaagcctcagtggtaccggcacacatttgaagaa
gcagagaaagggtttgatgagacgttggccaaggagaaaggcatgaatcgggatgatcgc
atccatggagccttgctgatcctcaacgagttggtccgcatcagcagcatggagggagag
cgcctgagagaagaaatggaagaaatcacacagcagcagctggtgcatgacaagtactgc
aaggacctcatgggcttcggcacgaaacctcgccacattacccccttcaccagtttccag
gctgtccagcccccgcagtccaatgccttggtgggactgctggggtacagctctcaccaa
ggcctcatggggttcggggcttcccccagcccagcgaagtccaccctggtggagagtcga
tgttgcagagacctgatggaggagaaatttgatcaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccagatgacaatccttaatttgttgccccgcctggct
gcgtttcgaccttctgccttcacagatacccagtacctccaagacaccatgaaccatgtc
ttaagctgtgtcaagaaggagaaggaacgtacagcagccttccaagccctggggctgctt
tctgtggctgtgagatctgagtttaaggtctatttacctcgtgtgctggacatcatccgt
gcagccctaccacctaaggactttgcccataagagacagaaggccatgcaggtggatgcc
acagtgttcacctgcatcagcatgctggcccgggcaatggggccaggcatccaacaggat
atcaaggagctgctggagcccatgctggcagtgggactgagccctgccctcactgctgtg
ctctacgacctgagccgtcagattccacagctgaagaaggacatccaggatgggcttctg
aagatgctgtccctggtcctgatgcacaaacccctccggcacccgggcatgcccaagggc
ctggcccatcagctagcttcccctggcctcacagccctgcctgaggccagtgatgtgggc
agcattactcttgcccttcgaacccttggcagctttgagtttgaaggccactctctgacc
cagttcgtccgccactgtgcagatcatttcctaaacagcgaacacaaggagatccgcatg
gaagctgcccgcacctgctcccgcctgctcacgccctccgtccacctcatcagtggccac
gctcacgtggtcagccagaccgcagtgcaagtggtggcagatgtgctcagcaaactgctc
gtggttgggataacagatcctgaccctgacatccgctactgtgtcttggcatccctggat
gagcgctttgatgcacacctggcccaggcagagaatttacaggccctgtttgtggccctg
aacgaccaggtgtttgagatccgggagctggccatctgcaccgtgggccggctcagtagc
atgaacccggccttcgtcatgcctttcttgcgcaagatgctcatccagattctgacggag
ctggagcacagcggcattggaagaatcaaagagcagagtgcccgcatgctggggcacctg
gtctccaatgccccacggctcatccgcccctacatggagcccattctgaaggctttaatt
ttgaaactgaaagatccggaccctgacccaaacccaggtgtgatcaataacgtcttggct
acaataggagaattggctcaggttagtggcctagaaatgaggaaatgggtggatgaactc
tttattatcatcatggacatgctccaggactcctctctgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctatgtggtggagccctacaggaag
taccccactttgcttgaggtccttctgaattttctgaagactgagcagaaccagggtaca
cggagagaggctatccgtgtgttagggcttctgggggccctggatccctacaagcacaaa
gtaaacataggcatgattgaccagtcccgcgacgcttctgctgtcagcctgtctgaatcc
aagtcaagtcaggattcctccgactacagcaccagcgagatgctggtcaacatgggcaac
ctgcccctggatgagttctaccccgctgtgtccatggtggcgctgatgcggatcttccga
gaccagtccctctcgcaccatcacaccatggttgtccaggccatcaccttcatcttcaag
tccctgggcctcaagtgtgtgcagttcctgccgcaggtcatgcccacattcctcaatgtc
attcgggtctgtgacggggccatccgggaattcctgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatccgaccttacatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctcaatccagagcacgatcatccttctcattgagcagattgtg
gtagctcttgggggtgaatttaagctctaccttccccagctgatcccacacatgctacgt
gtcttcatgcatgacaacagcccaggccgcatcgtctccatcaaactgttggctgccatc
cagctgtttggcgccaacctggatgactatctgcatttgttgttgccccctatcgtgaag
ctgtttgacgccccggaagttccactgccgtctcggaaggcagcgttagagactgtggac
cgcctgacggagtccctggacttcactgactacgcctcccggatcattcatccgattgtt
cgaacgctggaccagagccctgaactgcgtcccacggccatggacacgttgtcttcgctg
gtcttccaactggggaagaagtaccaaattttcattccaatggtgaataaagtcctggtg
cgacaccgaatcaaccatcagcgctatgatgtcctcatctgcagaatcgtcaagggatac
acccttgctgatgaagaagaagaccctttgatttaccagcatcgaatgctgaggagtggc
caaggggatgcattggctagtgggccagtagaaacaggacccatgaagaaactgcatgtc
agcaccatcaacctccaaaaggcttggggagctgccagaagggtctccaaagatgactgg
ttggagtggctgagacggctgagtctggagctcctgaaggactcttcgtcgccttccctg
cgctcgtgctgggccctggctcaggcctacaacccgatggccagggatctttttaatgct
gcatttgtgtcctgctggtctgaactgaatgaagaccagcaggatgaactcatcagaagc
atcgagttggccctcacctcgcaggacatcgccgaagtcacgcagaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgccattgagagatgacaatggcatt
gtcctcctgggtgagagggctgccaagtgccgagcatacgccaaagcactacactacaaa
gaactggagttccagaaaggtcccacccctgccatcctagagtctctcatcagcattaat
aataagctacagcaaccagaggcagctgccggggtgttagaatatgccatgaaacacttt
ggagagctggagatccaggccacctggtatgagaaactgcacgagtgggaggacgcgctc
gtggcctacgataagaagatggacaccaacaaggatgacccggagctgatgctgggccgc
atgcgctgcctcgaggccctgggggaatgggggcagctccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccgcatggctgctgcagctgca
tggggtttaggtcagtgggacagcatggaggagtacacctgtatgatccctcgggacacc
cacgatggggcattttatagagctgtgctggcactgcatcaggacctcttctccttggca
caacagtgcatcgacaaagccagagacctgctggatgctgagttaaccgctatggcagga
gagagctacagtcgggcatatggggccatggtctcttgccatatgctctccgagctggag
gaggttatccagtacaaacttgtccctgagcgacgggagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtattgtggaagactggcagaaaatcctgatggtgcgg
tcactcgtggtcagccctcatgaggacatgaggacctggctcaagtatgccagtctctgt
gggaagagtggcaggctggcccttgctcataaaaccttagtgttgctcctgggagttgat
ccatcgcggcaacttgaccatcctctgccaacagttcaccctcaggtgacctacgcctac
atgaaaaacatgtggaagagtgctcgcaagatcgatgccttccagcacatgcaacacttc
gtgcagaccatgcagcagcaggcccagcatgctatcgccaccgaggaccagcagcacaag
caagagctgcacaagctcatggcccggtgtttcctgaaactcggggagtggcagctgaac
ctgcagggcatcaacgagagcaccatccccaaggtgctgcagtactacagcgcggccaca
gagcacgaccgcagctggtacaaggcctggcacgcgtgggcagtgatgaacttcgaagct
gtgctgcactacaagcatcagaaccaagcccgtgacgagaagaagaagctgcggcacgcc
agcggggccaacatcaccagcacaaccacggccgccaccacagcggccacggccacggct
accgccaccagcaccgagggcagcaacagcgagagcgaggccgagagcaccgagaacagc
cccaccccgtctcctctgcagaagaaggtcactgaggatttgtccaaaaccctcttgatg
tacactgtccctgccgtccagggcttcttccgttccatctccttgtcacgaggcaacaac
ctccaggacacgctgagagtcctcaccttatggtttgactatggtcactggccagatgta
aatgaagccttagtggagggggtgaaagcgatccagattgacacttggttacaggttata
ccgcagctcatcgcaagaatcgatacgccgaggcccttggtgggccgcctcattcaccag
cttctcacagacattggccggtaccacccccaggccctcatctaccccctgactgtggcc
tctaagtccaccacgacggcccgccacaacgcagccaacaagatcctgaagaacatgtgt
gagcacagtaacaccctggtccagcaggccatgatggtgagcgaggagctaatccgcgtg
gccatcctctggcacgagatgtggcacgaaggcctagaagaagcgtctcgtctgtacttt
ggggagaggaacgtgaaaggcatgttcgaggtgctggagcccctgcatgctatgatggaa
cggggcccccagactctgaaggaaacatcttttaatcaggcatatggtcgagacttaatg
gaggcccaagagtggtgcaggaagtacatgaagtccgggaacgtcaaggacctcacccaa
gcctgggacctctattatcacgtgttcagacgaatctctaagcagctgcctcagctcacc
tccttagaactgcagtatgtttcccccaaacttctgatgtgccgggaccttgaattggcc
gtgccaggaacgtatgaccccaaccagccgatcattcgcattcagtccatagcgccgtcc
ctgcaggtcatcacctccaagcagaggccccggaagctgacgctcatgggcagcaacggg
catgagtttgttttcctcctgaagggccacgaagacctgcggcaggacgagcgagtgatg
cagctctttggcctggtgaacacccttctggccaatgacccaacgtctcttcgcaagaac
ctcagcatccagagatacgccgtcatccccttatccaccaactcgggcctcattggctgg
gtcccccactgtgacacgctgcacgccctcatccgggactacagagagaaaaagaagatc
cttctcaacatcgagcatcgcatcatgttgcggatggctccagactacgatcacctgaca
ctgatgcagaaggtggaggtgtttgagcacgctgtcaataacacagccggcgatgacctg
gccaagctgctgtggctgaaaagccccagctccgaggtgtggtttgaccgaagaaccaac
tacacccgctctttagcagtcatgtccatggttgggtatattttgggcctgggagataga
aaaccatctagcctggaaaataaataaataaataaaatacaaaacaaaagaaaacaatct
agccattggacttggtttttctcttttatttccccacaggttgctatgaccagggagaaa
ttccccgagaagattccatttagactaacaagaatgctgaccaatgctatggaggttact
ggtctggatggcaactataggatcacatgccacacggtgatggaagtgcttcgggaacac
aaggatagtgtcatggccgtgctggaagcctttgtctacgaccccttgctcaactggagg
ctgatggacacaaataccaaaggcaacaagcggtcccgaacaaggacggattcctactct
gctggccagtcagtagaaattttggacggtgtggaacttggggaacctgcccataagaaa
acagggaccacagtgccagaatccattcattctttcattggagatggtttggtgaaacca
gaggccctaaataagaaagctattcaaattattaacagggttcgagacaagcttactggt
cgggacttttctcatgacgaaaccctggatgtcccgacacaggtggaactgctcatcaaa
caagccacgtcacacgagaacctctgtcagtgctacatcggctggtgtcctttctggtaa

DBGET integrated database retrieval system