KEGG   Odobenus rosmarus divergens (Pacific walrus): 101363847
Entry
101363847         CDS       T05148                                 

Gene name
DLG1
Definition
(RefSeq) disks large homolog 1 isoform X2
  KO
K12076  disks large protein 1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04390  Hippo signaling pathway
oro04530  Tight junction
oro04660  T cell receptor signaling pathway
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101363847 (DLG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101363847 (DLG1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101363847 (DLG1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101363847 (DLG1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101363847 (DLG1)
   05165 Human papillomavirus infection
    101363847 (DLG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oro03036]
    101363847 (DLG1)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101363847 (DLG1)
SSDB
Motif
Pfam: Guanylate_kin PDZ MAGUK_N_PEST L27_1 PDZ_6 PDZ_assoc PDZ_2 SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 101363847
NCBI-ProteinID: XP_004391931
UniProt: A0A2U3VC42
LinkDB
Position
Unknown
AA seq 893 aa
MPVRKQDTQRALHLLEDYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTL
LDNPKCIDRSKQSEPIQPVNTWEISSLPSTTVTSETLPSSLSPSVEKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKANPPPVLVNTDSLETSTYV
NGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIIAGGAAAQDGRLRVN
DCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSI
AGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKN
TTDFVYLKVAKPTSMYMNDGYIPPDITSSSSQPVDNHVSPSSYLGHTPASPARYSPVSKA
MLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRII
SVNSVDLRTASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGS
GSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDG
ESDEVGVIPSKRRVEKKERARLKTVKFNSKTRGDKGSFNDKRKKNLFSRKFPFYKNKDQS
EQETSDADQHITSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDL
ISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGT
SVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQAR
KTFERAMKLEQEFTEHFTAIIQGDTLEDIYNQVKQIIEEQSGPYIWVPAKEKL
NT seq 2682 nt   +upstreamnt  +downstreamnt
atgccagtccggaagcaagacacccagagagcattgcaccttttggaagactatcgttca
aaactaagccagactgaagacagacagctcagaagttccatagaacgggttattaacata
tttcagagcaacctctttcaggctttaatagatattcaagaattttatgaagtgacctta
ctggataatccaaaatgtatagatcgttcaaagcagtctgaaccaatacagcctgtgaat
acttgggaaatttccagccttccaagtactactgtgacttcagaaacactgccaagcagc
cttagccctagtgtggagaaataccggtatcaggatgaagacacacctcctcaagagcac
atatccccacaaatcactaatgaggtgataggtccggaattagttcatgtctccgagaag
aacctgtcagaaattgagaatgtccatggatttgtttcccattctcatatttcaccaata
aaggcaaatcctcctccagtactggtcaacacagatagcttggaaacgtcaacttatgtt
aatggcactgatgcagattatgaatatgaagaaatcacacttgaaaggggaaattcaggg
cttggtttcagcattgcaggaggtacggacaacccacacattggagatgactcaagtatt
ttcattaccaaaattattgcagggggagcagctgcccaagatggaagattacgggtcaat
gactgtatattgcgagtaaacgaagtagatgttcgtgatgtgacacatagcaaagcagtt
gaagcattgaaagaagcagggtctattgtacgcttgtatgtaaaaagacggaaacctgta
tcagaaaaaataatggaaataaagctgattaaaggtcctaaaggtcttgggttcagcatt
gctggaggtgttggaaatcaacatattcctggggataatagcatctatgtaaccaaaata
attgaaggaggtgcagcacataaagatggtaaacttcagattggagataaacttttagca
gtgaatagtgtgtgtttggaagaagttactcatgaagaagcagtaactgccttaaagaac
acgactgattttgtttatttgaaagtggcaaaacccacaagtatgtatatgaatgatggc
tatataccacctgatatcaccagctcttcttctcaacctgttgataaccatgttagccca
tcttcctatttgggccatacaccagcatcaccagccagatactcacctgtttcaaaagca
atgcttggagatgatgaaattacaagggaacctagaaaagttgttcttcatcgtggctca
acaggcctgggtttcaacattgtaggaggtgaagatggagaaggaatatttatttccttt
atcttggctggaggacctgctgatcttagtggagagctcagaaaaggagatcgtattata
tcggtaaacagtgttgacctcagaactgccagccatgagcaagcagcagccgctttgaaa
aatgctggccaagctgtcacgattgttgcgcaatatcggcctgaagaatacagtcgtttt
gaagccaaaatacatgacttacgggagcagatgatgaatagtagcattagttcaggatca
ggttctcttcgaactagccagaagcgatccctctatgtcagagccctttttgattatgac
aagactaaagacagtggccttcccagtcagggattgaacttcaaatttggagatatcctc
catgttattaatgcttctgatgatgaatggtggcaagccaggcaggttacaccagatggg
gagagtgacgaagttggggtaattcccagtaaacgcagagttgagaagaaagaacgagcc
cggttaaaaacagtgaaatttaattctaaaacaagaggagataaagggtcattcaatgac
aagcgtaaaaagaacctcttttcccgaaaattccccttctacaagaacaaggaccagagt
gagcaggaaacaagtgatgctgaccagcatataacttctaatgccagcgatagtgaaagt
agttaccgtggtcaagaagaatatgtcttgtcttatgagccagtgaatcaacaagaagtt
aattatactcgaccagtgatcatattgggacctatgaaagacaggataaatgatgacttg
atctcagaatttcctgacaaatttggatcatgtgttcctcatacaactagaccaaaacga
gactatgaggtagatggaagagattatcattttgtgacttcaagagaacagatggaaaaa
gacattcaagaacataaatttattgaagctggccagtataacaaccatctgtatggaaca
agtgttcagtctgtgcgggaagtagcagaaaagggcaaacactgtatcctcgatgtgtct
ggaaatgccataaagagattacagattgcacaactttacccaatctccatttttattaaa
cccaaatccatggaaaatatcatggaaatgaataagcgtctaacagaagaacaagccaga
aagacatttgagagagccatgaaactggaacaagaatttactgaacatttcacagctatt
atacagggagatactctggaagacatttataaccaagtgaagcagatcatagaagaacag
tctggtccttacatctgggttccagcaaaagaaaagttatga

DBGET integrated database retrieval system