KEGG   Odobenus rosmarus divergens (Pacific walrus): 101364118Help
Entry
101364118         CDS       T05148                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 5-hydroxytryptamine receptor 3C-like
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04726  Serotonergic synapse
oro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    101364118
  09157 Sensory system
   04742 Taste transduction
    101364118
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oro04040]
    101364118
Ion channels [BR:oro04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   101364118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 101364118
NCBI-ProteinID: XP_012420061
UniProt: A0A2U3ZN73
LinkDB All DBs
Position
Unknown
AA seq 456 aa AA seqDB search
MEEGWSVEGGVLLYLTVSFLLPGRSNTFTINCSGLDQHGVDPAAFQTIFNQKDFRPVINY
SIPTQVNISFTLSAILEVDEQLQLLTSFLWLKLIWNNPFISWDPEERGAISKLTVTTENL
WLPDIFIVESWVPGMDVDQTPEGLSAYVTNDGHVVYNKPMRVTSICSLDIFYFTFDQQNC
TLTFSSFLYTVENMLLGMEKEVWEIVDTSHDIVRTQGEWELLGINKATPKMSVGSSLFDQ
IMFYVAIRRRPSLYVINLVPSSFLIAIDTLSFYLPAESENRAPFKITLLLGYNVFPLMMN
KLLPASGTPLISVYFALCLSLMAVSLLETIFITYLLHLATTQPPPMPRWLHPLLFYWASP
RKCCPTALWKENVGPGLMPTHLPGKENLHLPILTQEPGQLVGKELGPREAELNGASGLTS
TQLADLWVQFSHMMDTFLFHLYLFFLXSSIITVIVL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggggtggtctgtggaggggggagtcctcctctacctcactgtcagctttttg
cttccaggaaggtcaaacactttcaccatcaattgctcaggcttagaccagcacggggtg
gaccctgctgccttccagactatatttaaccagaaggacttccgtccagtcatcaactac
agcatccccactcaggtcaacatctccttcactttgtctgccatcctggaagtggatgaa
caacttcagctgctgacatcatttctgtggttaaagttgatctggaataacccattcatc
agctgggatccagaagaacgtggtgccatcagtaaactcactgtgacaactgagaacttg
tggcttccagacatcttcatcgtagaatcatgggtaccaggcatggatgtggatcagacc
ccagaaggcctctctgcatatgtgaccaatgacggtcacgttgtgtataacaaaccaatg
cgggtgaccagcatctgtagcctggacatcttctacttcacctttgaccagcagaactgc
acactcaccttcagctctttcctctacacagtggaaaacatgttgctgggcatggaaaag
gaagtgtgggagatagtggacacctcacatgacattgtccgcacacaaggggagtgggag
ctcctgggcatcaacaaggccaccccaaagatgtctgtgggctccagcctttttgaccag
atcatgttctacgtggccatcaggcgcaggcccagcctctatgtcataaacctggtgccc
agtagctttctgatcgccattgacaccctcagcttctacctgccggcagaaagcgagaat
cgtgccccattcaagataacccttctgttgggctacaacgtcttcccgctcatgatgaat
aaactacttcctgctagtggcacccctctcatcagtgtctattttgccctgtgtctgtcc
ctgatggcggtcagcctgctggagaccatcttcatcacctacctgctgcacctggccacc
acccagcccccacccatgcctcggtggctccaccctctgctcttctactgggccagccca
aggaaatgctgccccactgcgctctggaaggagaatgtgggcccaggcctcatgcccact
cacctacctggtaaggaaaatctgcacctgcctatactgacccaggagccaggacaattg
gtagggaaggagctgggacccagagaggcagagctgaatggggcttcaggattgacaagc
acccagctagctgacctgtgggtgcagttcagccacatgatggacaccttcctcttccac
ctctacctgttcttcttgngctcctccattatcacggtcatcgtcctctga

DBGET integrated database retrieval system