KEGG   Odobenus rosmarus divergens (Pacific walrus): 101364398
Entry
101364398         CDS       T05148                                 

Gene name
NKX3-1
Definition
(RefSeq) homeobox protein Nkx-3.1 isoform X1
  KO
K09348  homeobox protein Nkx-3.1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro05200  Pathways in cancer
oro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101364398 (NKX3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101364398 (NKX3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101364398 (NKX3-1)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    101364398 (NKX3-1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 101364398
NCBI-ProteinID: XP_004402272
UniProt: A0A2U3W2S3
LinkDB
Position
Unknown
AA seq 231 aa
MLRAPEPRPREAGAATQSKPLTSFLIQDILRDGAERRGGHTSSPQPPRQPDPRRDQEPEP
ERGRGGAGAPEDEWSARPGTGQEADAPAEIEPDRHFETYLMDCENSAGSLPSLPQTSKQP
QKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQ
LTSDLGDLEKHSSLPALKEEGLSQASLLSMHNSYPYYPYLYCLGGWNPPFW
NT seq 696 nt   +upstreamnt  +downstreamnt
atgcttagggctcccgagccgcggcccagggaggcgggggcggccacccagtccaagccg
ctcacctccttcctcatccaggacattctgcgggacggcgcggagaggcgcggcggccac
acgagcagcccgcagcccccgcgccagccggacccgcggcgagaccaagagccggagccc
gagcgaggaagaggcggcgctggggcgcccgaggacgagtggagcgcccggcccggcacc
gggcaggaggccgacgcgccggcggagatcgagccagatagacactttgagacttatctg
atggactgtgaaaacagtgcaggctccttaccaagccttccgcaaacctcgaaacagccg
cagaagcgctcccgtgctgccttctcccacactcaggtcattgagttagagaggaagttc
agccaccagaagtatctgtcagcccctgaaagggctcacctggccaagaacctcaagctc
actgagacccaagtgaaaatatggttccagaacagacgctataagaccaagcgaaagcag
ctcacctcggacctgggagacctggagaagcactcctccctgccggctttgaaagaggag
ggcttgtcccaggcctctctcctctccatgcataacagctacccttactacccctacctg
tactgcttgggaggctggaacccacctttctggtag

DBGET integrated database retrieval system