KEGG   Odobenus rosmarus divergens (Pacific walrus): 101364496
Entry
101364496         CDS       T05148                                 

Gene name
YWHAG
Definition
(RefSeq) 14-3-3 protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04110  Cell cycle
oro04114  Oocyte meiosis
oro04151  PI3K-Akt signaling pathway
oro04390  Hippo signaling pathway
oro05160  Hepatitis C
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101364496 (YWHAG)
   04151 PI3K-Akt signaling pathway
    101364496 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101364496 (YWHAG)
   04114 Oocyte meiosis
    101364496 (YWHAG)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101364496 (YWHAG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101364496 (YWHAG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101364496 (YWHAG)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oro03400]
    101364496 (YWHAG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101364496 (YWHAG)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101364496 (YWHAG)
DNA repair and recombination proteins [BR:oro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101364496 (YWHAG)
Exosome [BR:oro04147]
 Exosomal proteins
  Proteins found in most exosomes
   101364496 (YWHAG)
SSDB
Motif
Pfam: 14-3-3 DUF722 DUF3504 Peptidase_C98 Orbi_VP5 SF3A2 FlaC_arch
Other DBs
NCBI-GeneID: 101364496
NCBI-ProteinID: XP_004399135
UniProt: A0A2U3VUW6
LinkDB
Position
Unknown
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggccgagcaggcggagcgctac
gacgacatggccgcggccatgaagaacgtgacagaactgaatgagccactgtccaacgaa
gagagaaacctcctgtctgtggcctacaagaatgttgttggggcacgccgttcttcctgg
agggtcattagtagcattgagcagaagacatctgcagatggcaatgagaagaagattgag
atggtccgtgcttaccgtgaaaaaatcgagaaggagctggaagcggtatgtcaggatgtg
ctgagcctgctggataactacctgatcaagaattgcagtgagacccagtacgagagcaaa
gtgttttacctgaagatgaaaggggactattaccgctacctggctgaagtcgccactgga
gagaagagggcgaccgtcgtggagtcctctgagaaggcctatagcgaagcccacgagatc
agcaaggagcacatgcagcctactcaccccattagattaggcctggctcttaactactcc
gttttctactacgagatccagaacgccccagagcaagcctgccacttggccaagaccgcc
ttcgatgacgccattgccgagctcgacactctgaacgaggactcctacaaggactccact
ctcatcatgcagctcctccgcgacaacctaacgctctggacaagcgatcagcaagacgac
gacggcggcgaaggcaacaattaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101377965
Entry
101377965         CDS       T05148                                 

Gene name
YWHAQ
Definition
(RefSeq) 14-3-3 protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04110  Cell cycle
oro04114  Oocyte meiosis
oro04151  PI3K-Akt signaling pathway
oro04390  Hippo signaling pathway
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101377965 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    101377965 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101377965 (YWHAQ)
   04114 Oocyte meiosis
    101377965 (YWHAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101377965 (YWHAQ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101377965 (YWHAQ)
   05160 Hepatitis C
    101377965 (YWHAQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oro03400]
    101377965 (YWHAQ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101377965 (YWHAQ)
DNA repair and recombination proteins [BR:oro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101377965 (YWHAQ)
Exosome [BR:oro04147]
 Exosomal proteins
  Proteins found in most exosomes
   101377965 (YWHAQ)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 101377965
NCBI-ProteinID: XP_004401855
UniProt: A0A2U3W1I8
LinkDB
Position
Unknown
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagacggagctgatccagaaggcgaagctggccgaacaggccgagcgctacgac
gacatggccacctgcatgaaggccgtgaccgagcagggcgccgagctgtccaacgaggag
cgcaacctgctctcggtggcctacaaaaacgtggtcgggggccgcaggtccgcctggagg
gtcatctcgagcatcgagcagaaaaccgacacctcggacaagaagttgcagctgattaag
gactaccgggagaaagtggagtctgagctaaggtccatctgcaccacggtgctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattacttccggtaccttgctgaagttgcatgtggtgatgatcgaaaacaa
acgatagataattcccaaggagcttaccaagaagcttttgatataagcaagaaagagatg
cagcccacacacccaatccgactggggctggctcttaacttttctgtattttactatgag
atccttaataacccagagcttgcctgcacactggctaaaacagcttttgatgaggccatt
gcagaacttgatacactgaatgaagattcatacaaagacagcaccctcatcatgcagttg
cttagagacaacctaacattatggacatcagacagcgcaggagaagaatgtgatgcggca
gaaggggcagaaaactaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101381520
Entry
101381520         CDS       T05148                                 

Gene name
YWHAB
Definition
(RefSeq) 14-3-3 protein beta/alpha
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04110  Cell cycle
oro04114  Oocyte meiosis
oro04151  PI3K-Akt signaling pathway
oro04390  Hippo signaling pathway
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101381520 (YWHAB)
   04151 PI3K-Akt signaling pathway
    101381520 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101381520 (YWHAB)
   04114 Oocyte meiosis
    101381520 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101381520 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101381520 (YWHAB)
   05160 Hepatitis C
    101381520 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oro03400]
    101381520 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101381520 (YWHAB)
DNA repair and recombination proteins [BR:oro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101381520 (YWHAB)
Exosome [BR:oro04147]
 Exosomal proteins
  Proteins found in most exosomes
   101381520 (YWHAB)
SSDB
Motif
Pfam: 14-3-3 FliM SF3A2 Peptidase_C98
Other DBs
NCBI-GeneID: 101381520
NCBI-ProteinID: XP_004414162
UniProt: A0A2U3WXG9
LinkDB
Position
Unknown
AA seq 244 aa
MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWR
VISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLK
MKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAG
EGEN
NT seq 735 nt   +upstreamnt  +downstreamnt
atggataaaagtgagctggtacagaaagccaaacttgccgagcaggccgagcgctatgac
gacatggctgcggccatgaaggccgtcacggaacaggggcacgaactctccaatgaggag
agaaatctgctctccgtcgcctacaagaacgtggtgggtgcccgccgctcttcctggcgc
gtcatctccagcattgagcagaaaactgagaggaatgagaagaagcagcagatgggcaaa
gagtaccgggagaagatagaggccgaactgcaggacatctgcaatgatgttctggagctg
ttggacaaatatcttattcccaatgctacacaaccagaaagcaaggtgttctacttgaaa
atgaaaggagattattttagatatctttctgaggtggcatctggagataataaacaaacc
actgtgtcgaactcccagcaggcttaccaggaagcatttgaaattagtaagaaagaaatg
cagcctacacacccaattcgacttggcctggcactgaatttctcagtcttctactatgag
attctaaactctcctgaaaaggcttgcagcctggcaaaaacggcatttgatgaagcaatt
gctgaattggataccctgaatgaagagtcttacaaagacagcaccctgatcatgcagttg
cttagggacaatctcacactgtggacgtcggaaaaccagggagatgaaggagatgctggg
gagggagagaactaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101383486
Entry
101383486         CDS       T05148                                 

Gene name
YWHAE
Definition
(RefSeq) 14-3-3 protein epsilon isoform X2
  KO
K06630  14-3-3 protein epsilon
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04110  Cell cycle
oro04114  Oocyte meiosis
oro04151  PI3K-Akt signaling pathway
oro04390  Hippo signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04722  Neurotrophin signaling pathway
oro05160  Hepatitis C
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101383486 (YWHAE)
   04151 PI3K-Akt signaling pathway
    101383486 (YWHAE)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101383486 (YWHAE)
   04114 Oocyte meiosis
    101383486 (YWHAE)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101383486 (YWHAE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101383486 (YWHAE)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101383486 (YWHAE)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101383486 (YWHAE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oro03400]
    101383486 (YWHAE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101383486 (YWHAE)
DNA repair and recombination proteins [BR:oro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101383486 (YWHAE)
Exosome [BR:oro04147]
 Exosomal proteins
  Proteins found in most exosomes
   101383486 (YWHAE)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 101383486
NCBI-ProteinID: XP_004404155
UniProt: A0A2U3W7H2
LinkDB
Position
Unknown
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggccgagcaggctgagcgatac
gacgaaatggtggaatcaatgaagaaagtagcagggatggatgtggagttgacagttgaa
gaaagaaacctcctatctgttgcatataaaaatgtgattggagccagaagagcttcctgg
agaataatcagcagcattgaacagaaagaagaaaacaagggaggagaagacaaactaaaa
atgattcgggaatatcggcaaatggttgagactgagctaaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgaatttgccacaggaaatgac
aggaaggaggctgcagagaacagcctagtggcttataaagctgctagtgatattgcaatg
acagaacttccaccaacgcatccaattcgcttaggtcttgctctcaacttttccgtattc
tactatgaaattcttaattcccccgaccgtgcctgcaggttggcaaaagcagcttttgat
gacgcaattgcagaactggatacgctgagtgaagaaagctataaggactctacacttatc
atgcagttgttacgtgataatttgacactatggacttcagacatgcagggtgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgaaaatcagtga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101384625
Entry
101384625         CDS       T05148                                 

Gene name
YWHAZ
Definition
(RefSeq) 14-3-3 protein zeta/delta isoform X2
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04110  Cell cycle
oro04114  Oocyte meiosis
oro04151  PI3K-Akt signaling pathway
oro04390  Hippo signaling pathway
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101384625 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    101384625 (YWHAZ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101384625 (YWHAZ)
   04114 Oocyte meiosis
    101384625 (YWHAZ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101384625 (YWHAZ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101384625 (YWHAZ)
   05160 Hepatitis C
    101384625 (YWHAZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oro03400]
    101384625 (YWHAZ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101384625 (YWHAZ)
DNA repair and recombination proteins [BR:oro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101384625 (YWHAZ)
Exosome [BR:oro04147]
 Exosomal proteins
  Proteins found in most exosomes
   101384625 (YWHAZ)
SSDB
Motif
Pfam: 14-3-3 CSN7a_helixI FliM Peptidase_C98
Other DBs
NCBI-GeneID: 101384625
NCBI-ProteinID: XP_004402400
UniProt: A0A2U3W322
LinkDB
Position
Unknown
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaatgagctggtgcagaaggccaaactggccgagcaggctgagcgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gtcgtctcaagtattgagcaaaagacggaaggtgctgagaaaaaacagcagatggctcga
gaatacagagagaaaattgagaccgagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagtttttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagactactaccgttacttggccgaggttgctgctggtgatgacaagaaaggg
attgtggatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
cagccaacacatcctattagattgggtctggcccttaacttctctgtgttctattacgaa
attctgaactccccggagaaagcttgctctcttgcaaagacagcttttgatgaagccatt
gctgaacttgatacattaagtgaagagtcctacaaagacagcacgctaataatgcaatta
ctgagagacaacttgacattgtggacatcggacacccaaggagacgaagctgaagcagga
gaaggaggggaaaattaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101386284
Entry
101386284         CDS       T05148                                 

Gene name
YWHAH
Definition
(RefSeq) 14-3-3 protein eta isoform X1
  KO
K16198  14-3-3 protein gamma/eta
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04110  Cell cycle
oro04114  Oocyte meiosis
oro04151  PI3K-Akt signaling pathway
oro04390  Hippo signaling pathway
oro05160  Hepatitis C
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101386284 (YWHAH)
   04151 PI3K-Akt signaling pathway
    101386284 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101386284 (YWHAH)
   04114 Oocyte meiosis
    101386284 (YWHAH)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101386284 (YWHAH)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101386284 (YWHAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101386284 (YWHAH)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oro03400]
    101386284 (YWHAH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101386284 (YWHAH)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101386284 (YWHAH)
DNA repair and recombination proteins [BR:oro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101386284 (YWHAH)
Exosome [BR:oro04147]
 Exosomal proteins
  Proteins found in most exosomes
   101386284 (YWHAH)
SSDB
Motif
Pfam: 14-3-3 DUF722 CodY
Other DBs
NCBI-GeneID: 101386284
NCBI-ProteinID: XP_004400063
UniProt: A0A2U3VX55
LinkDB
Position
Unknown
AA seq 246 aa
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFS
VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE
EAGEGN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgggggaccgagagcagctgctgcagcgggcgcggctggccgagcaggcggagcgctac
gacgacatggcctccgccatgaaggcggtgacagagctcaatgaacctctttccaatgaa
gatcgaaacctcctctctgtggcctacaagaatgtggttggtgccaggcgatcttcctgg
agggtcatcagcagcattgagcagaaaaccatggctgatggaaatgaaaaaaaattggag
aaagttaaagcttaccgggagaagattgagaaggagctggaaacagtgtgcaatgatgtc
ctggctctgcttgacaagttcctcatcaagaactgcaatgatttccagtatgagagcaag
gtattttacctgaaaatgaaaggcgattactaccgctacttggcagaggtagcttctggg
gagaagaaaaacagtgtggtcgaagcttctgaggctgcctacaaggaagcctttgaaatc
agcaaagagcacatgcagccaacgcaccccatccggctgggtctggccctcaacttctcc
gtgttctactatgagatccagaatgcacctgagcaggcctgcctcttagccaaacaagcc
ttcgatgatgccatagctgagctggacacactaaacgaggattcctataaggactccacg
ctcatcatgcagttgctgcgagacaacctcaccctctggaccagcgaccagcaggatgaa
gaagcaggagaaggcaactga

DBGET integrated database retrieval system