KEGG   Odobenus rosmarus divergens (Pacific walrus): 101364575
Entry
101364575         CDS       T05148                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04060  Cytokine-cytokine receptor interaction
oro04068  FoxO signaling pathway
oro04144  Endocytosis
oro04218  Cellular senescence
oro04350  TGF-beta signaling pathway
oro04380  Osteoclast differentiation
oro04390  Hippo signaling pathway
oro04520  Adherens junction
oro04659  Th17 cell differentiation
oro04926  Relaxin signaling pathway
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro05142  Chagas disease
oro05161  Hepatitis B
oro05166  Human T-cell leukemia virus 1 infection
oro05200  Pathways in cancer
oro05202  Transcriptional misregulation in cancer
oro05210  Colorectal cancer
oro05212  Pancreatic cancer
oro05220  Chronic myeloid leukemia
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101364575 (TGFBR2)
   04350 TGF-beta signaling pathway
    101364575 (TGFBR2)
   04390 Hippo signaling pathway
    101364575 (TGFBR2)
   04068 FoxO signaling pathway
    101364575 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101364575 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101364575 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    101364575 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101364575 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101364575 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101364575 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101364575 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101364575 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    101364575 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101364575 (TGFBR2)
   05212 Pancreatic cancer
    101364575 (TGFBR2)
   05225 Hepatocellular carcinoma
    101364575 (TGFBR2)
   05226 Gastric cancer
    101364575 (TGFBR2)
   05220 Chronic myeloid leukemia
    101364575 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101364575 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101364575 (TGFBR2)
   05161 Hepatitis B
    101364575 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101364575 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101364575 (TGFBR2)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101364575 (TGFBR2)
Protein kinases [BR:oro01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101364575 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101364575
NCBI-ProteinID: XP_004416562
UniProt: A0A2U3X331
LinkDB
Position
Unknown
AA seq 567 aa
MGRGLLRGLWPLHIVLWTRIASTIPPQVQKSVNNDMMVTDNNGVIKFPQLCKFCDVRSST
CDNQKSCMSNCSITSICEKPHEVCLAVWRKNDENITLETLCHDPKDTYHGIVLEDAASPK
CIMKEKKVLGETFFMCSCSSDECNDYIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAI
AVIITFYCYRVHRQQKLSPSWETSKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQTVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSPNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgcatc
gccagcacgatcccgcctcaagttcagaagtcggttaataatgacatgatggtcactgac
aacaatggtgtcatcaaatttccgcaattgtgtaaattttgcgatgtgagatcttccacc
tgtgacaaccagaaatcctgcatgagcaactgcagcattacatccatctgtgagaagcca
catgaagtctgtctggctgtctggagaaagaatgatgagaacataacactagagacgctt
tgccatgaccccaaggacacctaccatggaatcgttctcgaagatgctgcttctccaaag
tgtattatgaaggaaaaaaaggtgttgggcgagactttctttatgtgttcctgtagctcc
gacgagtgcaatgactatatcatcttctccgaagaatatgccaccaacaaccctgacctg
ttgttagtcatattccaagtgacaggcgtcagcctcctgccacccctgggaatcgccata
gccgtcatcatcaccttctactgctaccgcgttcaccggcagcagaagctgagcccgtcc
tgggagaccagcaagccgcggaagctcatggagttcagcgagcacctggcaatcattctg
gaagatgaccgctccgacatcagctctacctgtgccaacaacatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtggggaaaggtcgcttcgccgaggtctacaag
gccaagctgaagcagaacacttcagagcagttcgagactgtggcggtcaagatcttccct
tacgaggagtatgcctcctggaagacggagaaggacatcttctcagacatcaacctgaag
catgagaacatcctgcaattcctgacggccgaggagcggaagacggagctggggaagcag
tattggctgatcactgccttccatgccaagggcaacctacaggaatacctcacgcggcac
gtcatcagctgggaggacctgcgcaagctgggcagctccctcgcccggggcattgctcac
ctgcacagcgaccacaccctgtgcgggaggcccaagatgcccatcgtgcacagggacctc
aagagttccaatatcctcgtgaagaacgacctgacctgctgcctgtgtgactttgggctt
tccctgcgcctcgacccaactctgtctgtggatgacctggctaacagtgggcaggtggga
accgcaagatacatggctccagaagtcctagagtccaggatgaatttggagaatgttgaa
tccttcaagcagacggatgtctactccatggctctggtactctgggagatgacatctcgc
tgtaatgcagtgggagaagtgaaagattacgagcctccatttggctccaaggtgcgggag
catccctgtgttgagagcatgaaagacaacgtgctgagagaccgagggcgaccagaaatc
cccagctcctggctcaaccaccagggcatccagacggtgtgcgagactctgaccgagtgc
tgggaccatgaccccgaggcccggctcacggcccagtgcgtggcggagcgcttcagcgaa
ctggagcacctggacaggctctcagggaggagctgctccgaggagaagatcccggaagat
ggctcaccgaacactaccaaatag

DBGET integrated database retrieval system