KEGG   Odobenus rosmarus divergens (Pacific walrus): 101364757Help
Entry
101364757         CDS       T05148                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oro01002]
    101364757 (TMPRSS9)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101364757 (TMPRSS9)
Peptidases [BR:oro01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101364757 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 101364757
NCBI-ProteinID: XP_004395438
UniProt: A0A2U3VKI3
LinkDB All DBs
Position
Unknown
AA seq 1058 aa AA seqDB search
MEPTAGDLQLVPGAAKEVPAPDATCCRVALSAVVATSIVMVTLGVLMAFLSTQGVDVEHT
AALQGVHYACSLQQETSEYYRTLTPTLERLLHFLLQALQSLSLGLEKELLQQGLRARLQG
HGIPLAAHGTIVSAELTGNQKGPLTERDLKSGYCPGNTFSCQNSQCVTKVNPECDDRVDC
SDGSDEAHCDCGLQPGWKTAGRIVGGMEASPGEFPWQVSLRENNEHFCGAAIVRARWLVS
AAHCFNEFQDPREWVAYAGTTYLSGAEASTVRARVARILPHPLYNPDTADFDVAVLQLDS
PLPFGRHVQPVCLPAATHVFPPRRKCLISGWGYLREDFLVKPETLQKATVELLEQGLCAS
LYGHSLTDRMVCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGV
YARVTRLRDWILEAITMVSKPLAPTVAPASASHSTAWPASPESPVVHTPARPTRGPSTAP
PDSVTASKPQACGARPAMEKPTRIVGGLGAASGEVPWQVSLKEGSRHFCGATLVGDRWLL
SAAHCFNHTKVELVRAHLGTASLTGVGGNPVKMGLKRLVLHPQYNPGILDFDVAVLELAR
PLGFNTFIQPVCLPLAIQKFPVGRKCMISGWGNTQEGNATKPDILQRASVGIIDQKACNA
LYNFSLTDRMLCAGFLEGKVDSCQGDSGGPLACEEAPGVFYLAGIVSWGVGCAQAGRPGV
YTRITRLKGWILDTMSLGPLPSPPLPTTRPPPATRPPSRTAAGPTVPGVLASRATLPATH
GATSQPAGTVSTAAGGQTPLPSTPGTTSGFQPPDCGLAPVAAMTRIVGGSAAGRGEWPWQ
VSLWLRRREHRCGAVLVAERWLLSAAHCFDVYGDPKQWAALLGTPFLSGAEGQLERVARI
YKHPFYNLYTLDYDVALLELAGSVRRSRLVRPICLPEPTPRPPDGARCVITGWGSVREGG
SMARQLQKAAVRLLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGR
WVLTGVTSWGYGCGRPHFPGVYTRVAAVRGWIGQNIQE
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atggaacccacagcgggtgacttacagcttgtgcctggggcagcaaaggaagtcccagcg
cccgacgccacgtgctgccgtgtggccctctccgctgtggtggctaccagcattgtcatg
gtcaccctgggagttctcatggccttcctctctacacagggtgtcgacgtggagcacacg
gctgcgctgcaaggggtccattatgcctgcagcttgcagcaagagacctcagaatactac
cgcacgctgacgcccactctggaaaggcttctacacttcttgctgcaagccctgcagtca
ctgagcttgggcctggagaaggagctgttgcagcagggactcagagcaaggctgcagggg
catggtatccccctggctgcccatggcaccattgtgtccgctgagctcacgggcaatcag
aaagggccactgacagaaagagacttaaaatcaggttactgtccagggaacaccttttcc
tgccagaacagccagtgtgtgaccaaagtgaacccggagtgtgatgaccgagtggattgc
tccgatggatctgatgaggcccactgtgactgcggtctacagcctggctggaagacggct
ggccggatcgtgggcggcatggaagcgtcccctggggagttcccgtggcaagtcagcctt
cgagaaaacaacgaacacttctgtggggctgccatcgtcagggcccggtggctggtgtct
gcagcccactgcttcaacgagttccaagatccgagagagtgggtggcctacgcgggcacg
acgtaccttagcggggccgaggccagcacggtgcgggcgcgcgtcgcccgcatcctcccg
cacccgctgtacaacccagacacggccgacttcgacgtggcggtgctgcagctggacagc
cccctgcccttcggcaggcacgtccagcctgtgtgcctccctgcagccacgcacgtcttc
ccgccccggaggaagtgcctgatctccggctggggctacctcagggaggacttcctggtg
aagccagagacgctgcagaaagccaccgtggagctgctggaacagggcctatgtgccagt
ctgtacggccactcactcaccgacaggatggtgtgtgccggctacctagatgggaaggtg
gactcctgccagggtgactcaggaggtcccctggtctgtgaggagccctccggcaggttc
ttcctagccggcatcgtgagctgggggattggctgtgcggaagcccggcgtcccggggtc
tatgcccgcgtgaccaggctgcgggactggatcctggaggccatcaccatggtgagcaag
cctctggcccccaccgtggctcctgcctccgccagccacagcactgcctggcccgccagt
cccgagagcccggtggtccacacccccgccagacccacacggggccccagcacggcacct
cctgactcagtgacagcctctaagccacaagcgtgtggggccaggcccgccatggagaag
cccacgcggatcgtgggtggtctgggagccgcctctggggaggtgccctggcaggtcagc
ctgaaggaaggttcccggcacttctgcggcgcgaccctggtgggtgaccgctggctgctg
tcggctgcccactgcttcaaccacacgaaggtggagctggtgcgggcccacctgggcacc
gcgtccctcacgggcgttggcggaaacccagtgaagatggggctcaagaggctggtgctg
cacccccagtacaaccccggcatcctggactttgacgtggctgtcctggagctggccagg
cccctgggtttcaacacgttcatccagcccgtgtgcctgcccctggccatccagaagttc
cctgtgggccgcaagtgcatgatatctggatggggtaacacgcaggagggcaacgccacc
aagcccgacattctacagagagcgtctgtgggcatcatagaccagaaggcctgcaacgcc
ctctacaacttctccctcacggaccggatgctgtgcgccggcttcctggagggcaaggtc
gactcctgccagggcgactctgggggacccctggcctgcgaggaggcccccggcgtgttt
tacctggcggggatcgtgagctggggggtcggctgtgctcaggccgggaggcctggcgtg
tacactcgcatcaccaggctgaagggctggatcctggacaccatgtccttgggccccctg
cccagccctcccctgcccaccacgaggcccccgcccgccaccaggcctccctccaggacg
gcggctggccccacggtcccgggggtcctggccagcagagccaccctcccggccacccac
ggggcgaccagccaacctgccggcaccgtgagcaccgctgcggggggacagacaccactt
ccaagcacccctggcaccacctcgggcttccagccaccagactgcggcctggcaccggtg
gcagcgatgaccaggatcgtgggcggcagcgccgcgggccgcggggaatggccgtggcag
gtgagcctgtggctgcggcgccgggagcaccgctgcggggccgtcctggtggccgagagg
tggctgctgtcggcggcgcactgcttcgatgtctacggggaccccaagcagtgggcggcc
ctcctgggcacgccgttcctgagcggcgccgaggggcagctggagcgcgtggcgcgcatc
tacaagcaccccttctacaacctctacacgctcgactacgacgtggcgctgctcgagctg
gcgggctccgtgcgccgcagccgcctggtgcggcccatctgcctgcccgagcccacgcca
cggccccccgacggcgcgcgctgcgtcatcaccggctggggctcggtgcgcgaaggaggc
tcgatggcgcggcagctgcagaaggcggccgtgcgcctcctcagcgagcagacgtgccgc
cgcttctacccagtacagatcagcagccgcatgctgtgcgccggcttcccgcagggcggc
gtggacagctgctcgggtgacgctgggggacccctagcctgcagggagccctctggccgg
tgggtgctaactggggtcaccagctggggttacggctgcggacggccccacttcccgggt
gtctatactcgcgtggctgccgtgagaggctggatcgggcagaacatccaggagtga

DBGET integrated database retrieval system