KEGG   Odobenus rosmarus divergens (Pacific walrus): 101364776
Entry
101364776         CDS       T05148                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04020  Calcium signaling pathway
oro04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101364776 (CACNA1E)
   04020 Calcium signaling pathway
    101364776 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101364776 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oro04040]
    101364776 (CACNA1E)
Ion channels [BR:oro04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101364776 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 101364776
NCBI-ProteinID: XP_012416622
UniProt: A0A2U3ZCC6
LinkDB
Position
Unknown
AA seq 2305 aa
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFTNNSGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVLTVFQ
CITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEVGKAKEYIQTR
QVFLKIDQQNRIEREKNGRVQWIFRAEEVMLAEENKNAGTSALEVLRRATIKRSRTEAMT
RDSSDEHCVDISSVGTPLARPSIKSAKVDGASYFRHKERLLRISIRHMVKSQVFYWIVLS
LVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFD
FGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSII
SLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWNEVMY
NGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFN
QKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSGHLRERRRRHHMSVWEQRTSQ
LRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLGLGLEKCE
EERISRGGSLKGDGGDLSSALDNQRSPLSLGKREPPWLARPCHGNCDPTQPEAGGGETVV
AFEDRARHRQSQRRSRHRRVRTEGRELSSTSRSRSASQERSLDEAAPPEGEKDSEPRGSH
AGQAPTIQEEERGQDLRRTNSLMVPRGSGLAGALDEDNTPLVLPQPELEVGKDTALTEQE
AEGSSERALLGDVQLDMGRAISQSEPDLSCATNTDKATTDSTSVTVAIPDLGPLVDSAVV
HISNKTDGEASPLKEAEIKEEEEEVEKKQKKEKRETGKAMVPHSSMFIFSTTNPIRRACH
YIVSLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIKMID
QGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLK
TIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEK
ECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEE
DRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACI
DFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYE
LALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNT
SGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQ
VFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSG
QNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRV
WAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTS
TLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGK
IYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQDPVS
GLSGRSGYPSMSPLSPQEIFQLACMDPADGQFQEQQSLEPEVSELKSVQSSNHGIYLPSD
TQEHTGSGRASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYK
SRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQ
ADWESPERQQSRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRSRRQLPPVPPKPRP
LLSYSSLLRHTGSISPPADGREGGSPLTSQALESTEAGLVEAPSSRLGKQGQHCSPQRYI
SEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHGWQMPNGHYRRRRR
GGPGPGVMCGAVGDLLSDTEEDDKC
NT seq 6918 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccggggtcgggcgatggagactcggac
cagagcaggaaccggcaaggaaccccggtgccggcctcggggccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccgtttgagtacatgattttggccaccatcatt
gccaactgcattgtcttggccctggaacagcatcttcctgaggatgacaagaccccgatg
tcccgcagactggagaagacagaaccgtatttcattgggatcttttgctttgaagctggt
atcaaaattgtggccctggggttcatcttccataagggctcgtacctccgcaatggctgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggccacggcaggaacccacttc
aacacacatgtggacctgaggaccctccgggctgtgcgtgtcctgagacccctgaagctc
gtgtcagggatacctagcctgcagattgtactgaagtccatcatgaaggccatggtacct
cttctgcaaattggtcttctgctcttctttgccatcctgatgtttgctatcattggcttg
gagttctacagtgggaagttacaccgtgcatgtttcacgaacaattcaggatttgacccc
cctcacccatgtggtgtgcagggctgcccagctggttatgagtgccgggactggattggc
cccaatgatgggatcacccagtttgataacatactttttgctgtgctgactgtcttccaa
tgcatcaccatggaagggtggactaccgtgctgtacaataccaatgatgccttaggagcc
acctggaactggctgtacttcatccccctcatcatcattggatccttctttgttctcaac
ctagttctgggagtgctctccggagaagtgggaaaagccaaggaatacattcaaactcgt
caggtttttcttaaaatagatcagcagaacagaatagagagggagaagaacggaagggtg
cagtggatttttagggcggaggaagtcatgctcgctgaagaaaataaaaatgctgggacg
tcagccttagaagtgcttcgaagggcaaccatcaaacggagccggacggaggccatgact
cgagactccagcgatgagcactgtgttgacatctcctctgtgggcacacctcttgcccga
cccagcatcaaaagtgcaaaggtggacggggcctcctatttccggcacaaagaaaggctt
ctgcgcatctctatccgccacatggttaaatcccaggtgttttactggatcgtgttgagc
cttgtggctctcaacaccgcctgcgtggccatcgtccatcacaaccagccccagtggctc
acccatctcctctactatgcagaatttttgtttctgggactgttcctcttggagatgtcc
ctgaagatgtatggcatggggcctcgactctattttcactcttcgttcaactgttttgat
tttggggtcacagtgggcagtatctttgaagtggtctgggcaatcttcagacctggtaca
tcttttggaatcagtgtcttgcgagctctccggcttctaagaatatttaaaataaccaag
tattgggcatctctgcgaaatttggtggtgtccttgatgagttctatgaagtctatcatc
agtttgctcttcctcctcttcctcttcatcgttgtctttgctctcctaggaatgcagctc
tttggaggcaggtttaactttaatgatgggactccttcggcaaactttgacacattccct
gcagccatcatgactgtattccagatcctaacaggggaggactggaacgaggtgatgtac
aatgggatccgttcccagggtggggtcagctcaggcatgtggtcagctatctatttcatt
gtgctcaccttgtttggaaactacacactgctgaatgtgttcttggccattgctgtggac
aatctggccaatgcccaagagctgaccaaggatgagcaagaagaagaggaggctttcaac
cagaaacatgcattgcagaaggccaaggaggtcagcccgatgtctgcacccaacatgcct
tctatcgaaagagacagaaggagaagacaccacatgtcgatgtgggagccacgcagcggc
cacctgagggagcggaggcgccggcaccacatgtcggtgtgggagcagcgcaccagccag
ctgagaaggcacatgcagatgtccagccaggaggccctcaataaagaggaggccccacca
atgaaccccctcaaccccctcaacccgctgagtcccctcaacccactcaatgcccacccc
agcctctaccggagacccaggcccatcgagggcctgggcctgggcctggagaagtgtgag
gaggagcgcatcagccgtggggggtccctcaagggggatggaggggacctgtcgagcgcc
ctggacaaccagaggagccccttgtccctgggcaaacgggagccaccgtggctggccagg
ccctgtcatggcaactgtgatccgacccagccagaggctgggggaggggagaccgtggtg
gcctttgaggaccgtgccagacacaggcagagccagcggcgcagccggcaccgtcgcgtc
aggacagaaggcagggagctctcttccacctcccggagcaggtctgccagccaggagcgg
agtctggatgaggcggcgccccccgagggggagaaagacagcgagcccaggggcagccac
gcgggccaggcacccacaatccaggaagaagagcgaggccaagacttaaggaggaccaac
agtctgatggtgcccagaggctccgggctggcaggagccctcgacgaggacaacacgccc
ctggtcctgccccagccggagctggaagtggggaaggacacggcgctgaccgagcaggag
gccgagggcagcagtgagcgggccctgctgggcgacgtgcagttggacatgggcagggcc
atcagccagagtgagcctgacctctcctgcgccaccaacacagacaaggccaccaccgac
agcaccagcgtcactgttgccatccccgacttgggccccttggtggactcagctgtggtt
cacattagcaacaagactgatggagaagccagtcccctgaaggaggcagagatcaaagag
gaggaggaggaggtggagaagaagcagaagaaggagaagcgtgagacgggcaaagccatg
gtgccccacagctccatgttcatcttcagcaccaccaacccgatccgcagggcctgccac
tacatcgtgagcctgcgctactttgagatgtgcattctcctggtgatcgcggccagcagc
atcgccctggcagccgaggaccctgtcctgaccaactcggagcgcaacaaagtcctgagg
tattttgactatgttttcactggcgtgttcacctttgagatggtcataaagatgatagac
cagggcttgatcctgcaggacgggtcctacttccgagacctgtggaacatcctggacttc
gtggtggtggttggcgcgttggtggccttcgctttggcgaacgctttgggaacaaacaag
ggacgagacatcaagaccatcaaatctctgagggtcctccgagttcttaggccgctgaag
accatcaagcgcttgcccaagctcaaggctgtcttcgactgtgtggtgacttccttgaag
aacgtattcaacatcctcattgtctacaagctcttcatgttcatctttgctgttattgcc
gtccagctcttcaagggaaaattcttttattgcacagacagttccaaagacacagagaaa
gagtgcataggcaactatgtagatcatgaaaaaaacaagatggaggtgaaaggccgggaa
tggaagcgccacgaattccactacgacaacattatctgggccctgctgaccctcttcacc
gtctccacaggggaaggatggcctcaagtcttacagcattctgttgatgtgacagaggaa
gaccgaggaccaagccgcagcaaccgcatggagatgtccatcttttatgtggtctacttt
gtggtcttccctttcttctttgtcaatatctttgtggctcttatcatcatcaccttccag
gagcaaggggacaagatgatggaggagtgcagcctggagaagaacgagagggcgtgcatc
gacttcgccataagcgccaaacctctcacccgctacatgccgcagaacagacacaccttc
cagtaccgcgtctggcacttcgtggtgtccccgtccttcgagtacaccatcatggccatg
atcgccttgaacactgtcgtgctgatgatgaagtactactctgctccctgcacctacgaa
ctggccctgaagtacctgaatattgccttcacgatggtgttctccctggaatgtgtccta
aagatcatcgcgttcggcttcttgaactattttcgagacacctggaatatctttgacttc
atcacggtgattggcagtatcacagaaatcattctgacagacagcaagctggtgaacacc
agtggcttcaacatgagctttctgaagctcttccgagctgcccgcctcatcaagcttcta
cggcagggctacaccatccgtattttactttggacctttgtgcagtcctttaaggccctc
ccctatgtctgccttttgattgccatgcttttcttcatctatgccatcattgggatgcag
gtatttggaaacataaaattagatgaggagagtcacatcaaccggcacaacaacttccgg
agtttctttgggtccctcatgttactcttcaggagtgccacaggtgaggcctggcaggag
ataatgctgtcgtgcctcggggagaagggctgcgagcccgacaccactgcaccttcgggg
cagaacgagaatgagcgctgtggcacagatctggcctacgtttactttgtctccttcatc
ttcttctgctccttcttgatgctcaacctgttcgtggccgtcatcatggacaactttgag
tacctgactcgggactcctccatcttagggcctcaccacttggatgagtttgtccgtgtc
tgggcagaatatgacagagctgcatgtggccgcatccattacactgagatgtatgaaatg
ctgactctcatgtcaccaccgctaggcctcggcaagagatgtccctccaaagtggcatat
aagaggttggtcctgatgaatatgccggtagctgaggacatgacagtgcacttcacctcc
acacttatggctctgatccggacagctctggacatcaaaatcgccaaaggtggtgcagac
aggcagcagctagactcggagctgcaaaaagagaccctggccatctggcctcacctgtcc
cagaagatgctagatctgcttgtgcccatgcccaaagcctctgacctgactgtgggcaaa
atctatgcagcaatgatgatcatggactactataaacagagtaaggtgaagaagcagagg
cagcagctggaggaacagaaaaatgcacccatgttccagcgcatggagccctcatctctg
cctcaggagatcattgccaatgccaaagccctgccctatctccagcaggaccctgtctca
ggcctgagtggccgtagcggatacccttcgatgagtccgctctccccccaggaaatattc
cagttggcttgtatggacccagccgatggacagttccaggaacagcagtctctggagcca
gaggttagtgaattaaaaagcgtgcagtcctctaaccatggcatctaccttccttcggac
acccaggagcatacgggatcggggagggcatcctctatgccacgcctgactgtggatccc
caggtggtgacagatcccagctccatgagacgttcattttccacgattcgggataagcgt
tcaaattcctcatggttagaggaattctccatggagagaagcagtgaaaacacctacaag
tcacgtcgtcggagttaccactcctcactgagactgtcagctcatcgcctgaattctgac
tcaggccacaagtctgacacccatcgctcagggggcagagagcgggggcggtcgaaagag
cgaaagcatcttctctctcccgatgtctcccgctgcaattcagaggagcgagggacccag
gccgactgggagtccccggagcgccagcagtccaggtctcccagtgagggccggtcacag
acccccaacagacagggcacaggttccctgagtgaaagctccatcccctccatctctgac
accagcaccccaagacgaagtcgccggcagctcccacctgttcccccaaagccacggccc
ctcctttcctacagctccctgctgcgccacaccgggagcatctccccaccggctgacgga
agagagggcggctccccgctcacctcccaggcactggagagcacggaggccggcctggtg
gaggctcccagctcccggctcggcaagcagggccaacactgctccccccagcgctacatc
tccgagccctacctggccctgcacgaagactcccacgcctcggactgtggcgaggaggag
acgctcaccttcgaagccgccgtggccaccagcctgggccgctccaataccattggctcg
gcgccgcctctgaggcatggctggcagatgcccaacgggcactatcggcggcggcggcgc
ggggggcctgggcccggcgtcatgtgtggggctgtcggcgacctcctgagtgacacggaa
gaagacgacaagtgctag

DBGET integrated database retrieval system