KEGG   Odobenus rosmarus divergens (Pacific walrus): 101364797
Entry
101364797         CDS       T05148                                 

Definition
(RefSeq) uncharacterized protein LOC101364797
  KO
K10784  T cell receptor alpha chain V region
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04020  Calcium signaling pathway
oro04064  NF-kappa B signaling pathway
oro04514  Cell adhesion molecules
oro04612  Antigen processing and presentation
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05135  Yersinia infection
oro05142  Chagas disease
oro05144  Malaria
oro05150  Staphylococcus aureus infection
oro05162  Measles
oro05166  Human T-cell leukemia virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05202  Transcriptional misregulation in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101364797
   04015 Rap1 signaling pathway
    101364797
   04064 NF-kappa B signaling pathway
    101364797
   04020 Calcium signaling pathway
    101364797
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101364797
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101364797
   04660 T cell receptor signaling pathway
    101364797
   04658 Th1 and Th2 cell differentiation
    101364797
   04659 Th17 cell differentiation
    101364797
   04672 Intestinal immune network for IgA production
    101364797
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101364797
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101364797
  09163 Immune disease
   05310 Asthma
    101364797
   05322 Systemic lupus erythematosus
    101364797
   05323 Rheumatoid arthritis
    101364797
   05320 Autoimmune thyroid disease
    101364797
   05321 Inflammatory bowel disease
    101364797
   05330 Allograft rejection
    101364797
   05332 Graft-versus-host disease
    101364797
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101364797
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101364797
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101364797
   05150 Staphylococcus aureus infection
    101364797
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101364797
   05170 Human immunodeficiency virus 1 infection
    101364797
   05162 Measles
    101364797
   05169 Epstein-Barr virus infection
    101364797
  09174 Infectious disease: parasitic
   05144 Malaria
    101364797
   05142 Chagas disease
    101364797
SSDB
Motif
Pfam: V-set Ig_3 ig I-set Ig_2
Other DBs
NCBI-GeneID: 101364797
NCBI-ProteinID: XP_004402222
UniProt: A0A2U3W2L3
LinkDB
Position
Unknown
AA seq 416 aa
MTFVFILTLGVLLFLRTGAQSVTQPDAHVTVPEESPLELRCNYSSLRPYLYWYVQYPNQG
LQLLLQYVSGNTKVQGIKGFKAELKDRETSFHLKKPSAHWSDSAVYFCAIPPNSKSMSTA
TQLTSFSDSQIQFQRQMLRYVNKPFSLSLNGVTGAVVELRPPALSLQEGSSSTLQCNFST
STTNVHWYRQDPGGRLIHLFYIPSGTKQNGRLNSTTVAKERRSSLYISSSQTTDSATYFC
AVDPQCSPGARSLCTNPQLGWAPPPAAFRSGARRTASVQLYHSLPYLQRVSGQQSNKSGQ
QQVKQVPQSLTVREGEISTLNCTYENSAFDYFLWYRQYTGKGPELLLAMLLVERTKEDGR
FTVSLNVSAKQFSLHVTAPQPGDSATYFCAAKAQCSPGTCSLAPNLKLRLQPNPTV
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgaccttcgtgttcatcttgacgcttggggtgcttctgttcctaagaaccggggcccag
tcggtgacccagcctgatgcccacgtcactgtccctgaagaatcccctctggagctgagg
tgcaactactcttctcttcggccctatctctactggtacgtgcagtaccccaaccaaggc
ctccagcttctcctccagtacgtatcagggaacaccaaggttcaaggtatcaaaggtttc
aaggctgaacttaaggaccgtgaaacctctttccacctgaagaaaccctcagcccattgg
agcgactcagctgtgtacttctgcgctatccccccaaattccaaatcaatgtctacagca
acacagctcacaagtttttctgatagtcaaatacagtttcagaggcaaatgttaaggtat
gtgaataagcccttttccctgagcctaaacggtgtgacaggcgcagtggtggagctgagg
cccccggccctgagtctccaggagggatccagttccacgctgcagtgcaatttttccacc
tctacgactaatgtgcactggtatcgccaagatcctgggggccgcctcatccacctgttt
tacattccttcagggacaaagcagaatggaagattaaactctacgacagtcgctaaggaa
cgccgcagctcactgtacatttcctcttcccagaccacagactcagccacttacttctgt
gcggtggatccacagtgctccccaggcgcccgcagcttgtgcacaaaccctcagctgggc
tgggctcctcctccagccgccttcagatcaggagcccgccgcacagcatctgtacagctt
taccactccttaccgtatctgcagagggtgagtggccaacagagtaataagagtggccag
cagcaggtgaaacaggtccctcaatctctgacagtccgggaaggagagatttctactctg
aactgtacttatgagaacagtgcgtttgactacttcctatggtaccgacagtacactggt
aaaggccccgaattattgctagccatgcttttggttgagagaacaaaggaggatggaaga
ttcacagtttccctcaacgtaagtgccaaacaattttcattgcacgtcacggctccccag
cctggagactcagccacctacttctgtgcagcaaaagcacagtgctccccaggcacctgc
agcctggccccaaacctgaagctgaggctccagccaaaccctactgtgtag

DBGET integrated database retrieval system