KEGG   Odobenus rosmarus divergens (Pacific walrus): 101364829
Entry
101364829         CDS       T05148                                 

Gene name
CD38
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00760  Nicotinate and nicotinamide metabolism
oro01100  Metabolic pathways
oro04020  Calcium signaling pathway
oro04640  Hematopoietic cell lineage
oro04921  Oxytocin signaling pathway
oro04970  Salivary secretion
oro04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    101364829 (CD38)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101364829 (CD38)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101364829 (CD38)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101364829 (CD38)
  09154 Digestive system
   04970 Salivary secretion
    101364829 (CD38)
   04972 Pancreatic secretion
    101364829 (CD38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oro04090]
    101364829 (CD38)
   00536 Glycosaminoglycan binding proteins [BR:oro00536]
    101364829 (CD38)
Enzymes [BR:oro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     101364829 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     101364829 (CD38)
CD molecules [BR:oro04090]
 Proteins
  101364829 (CD38)
Glycosaminoglycan binding proteins [BR:oro00536]
 Hyaluronan
  Cell surface receptors
   101364829 (CD38)
SSDB
Motif
Pfam: Rib_hydrolayse VasI
Other DBs
NCBI-GeneID: 101364829
NCBI-ProteinID: XP_004410935
UniProt: A0A2U3WP85
LinkDB
Position
Unknown
AA seq 305 aa
MANHRFSSVSEEEPCCNISKKTQICLCVFFGLLIAVIIAVPVGILMWRPPLKQWKGEGTT
AHLYEILLGRCYTYTQIVRPELGHKDCQKIVKAFTKAFLSKDPCSSTEQDYQPLMELTDE
PVPCNKTLFWSKSSELAHDYTRVRQDMFTLEDTLLGYMADGLKWCGDPGSSEMNYHSCPD
WREDCSNNSFSVFWNTVSKRFAEDACGVVHVVLNGSIRNTFDERSTFGRVEVFNLHPEKV
NRLQAWVMHDIGSVHSDSCSSSSINNLKQILKRRSITFSCQNNYRPIRLLQCVKNPGHSS
CGSYI
NT seq 918 nt   +upstreamnt  +downstreamnt
atggccaaccacagattcagttccgtgtccgaggaagaaccctgctgcaacatttccaag
aaaacccagatctgtctctgcgtcttttttggtctcctgatcgcggtgatcatcgcggtg
ccggtcgggatcctgatgtggcgccctccgctcaagcagtggaagggggagggcaccact
gcccatttgtacgagatcctcctgggtcggtgctacacctacactcaaatcgtgcgacct
gagctgggacacaaagactgccaaaagatagtgaaggcattcacaaaggcatttctttca
aaggatccttgcagcagcacagaacaggactatcagccgctaatggagctgacagatgaa
ccagtcccttgcaacaagacccttttttggagcaaatccagtgagctggcgcatgactac
acgcgggtccggcaggacatgttcacgctggaggacacactgctgggctacatggcggac
ggcctcaagtggtgtggagacccaggctcttctgaaatgaactatcactcttgtcccgac
tggagggaagactgcagcaacaactctttttctgtattctggaacacggtgtccaaaagg
tttgcagaagatgcctgtggtgtggtccatgtggtgctcaacgggtccatcagaaacacc
tttgatgaaagaagcacttttggacgtgtggaagtctttaatttgcatccagagaaggtt
aatagactacaggcctgggtgatgcatgacattggaagtgttcacagtgactcatgctca
agttcctccataaataatctgaaacagattctaaagagaagaagtattacattttcttgc
cagaataattacaggcctatcaggcttcttcagtgtgtgaaaaatcctgggcattcatct
tgcggatcttacatatga

DBGET integrated database retrieval system