KEGG   Odobenus rosmarus divergens (Pacific walrus): 101365039
Entry
101365039         CDS       T05148                                 

Gene name
CXCL8
Definition
(RefSeq) interleukin-8
  KO
K10030  interleukin 8
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04061  Viral protein interaction with cytokine and cytokine receptor
oro04062  Chemokine signaling pathway
oro04064  NF-kappa B signaling pathway
oro04072  Phospholipase D signaling pathway
oro04218  Cellular senescence
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro05132  Salmonella infection
oro05133  Pertussis
oro05134  Legionellosis
oro05135  Yersinia infection
oro05142  Chagas disease
oro05144  Malaria
oro05146  Amoebiasis
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05202  Transcriptional misregulation in cancer
oro05219  Bladder cancer
oro05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101365039 (CXCL8)
   04072 Phospholipase D signaling pathway
    101365039 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101365039 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101365039 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101365039 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101365039 (CXCL8)
   04621 NOD-like receptor signaling pathway
    101365039 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    101365039 (CXCL8)
   04657 IL-17 signaling pathway
    101365039 (CXCL8)
   04062 Chemokine signaling pathway
    101365039 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101365039 (CXCL8)
   05202 Transcriptional misregulation in cancer
    101365039 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    101365039 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101365039 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101365039 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101365039 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101365039 (CXCL8)
   05135 Yersinia infection
    101365039 (CXCL8)
   05133 Pertussis
    101365039 (CXCL8)
   05134 Legionellosis
    101365039 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101365039 (CXCL8)
   05171 Coronavirus disease - COVID-19
    101365039 (CXCL8)
   05164 Influenza A
    101365039 (CXCL8)
   05163 Human cytomegalovirus infection
    101365039 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101365039 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101365039 (CXCL8)
   05144 Malaria
    101365039 (CXCL8)
   05142 Chagas disease
    101365039 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101365039 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:oro00536]
    101365039 (CXCL8)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Chemokines
   101365039 (CXCL8)
Glycosaminoglycan binding proteins [BR:oro00536]
 Heparan sulfate / Heparin
  Chemokines
   101365039 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101365039
NCBI-ProteinID: XP_004392970
UniProt: A0A2U3VE74
LinkDB
Position
Unknown
AA seq 101 aa
MTSKLAIALLAVFLLSAALCEAAVLSRMSSELRCQCINTHSSPFHPKYIKELRVIDSGPH
CENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRAEKQES
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggctattgctctcttggcagttttcctgctttctgcagctctgtgc
gaagctgcagttctgtcaagaatgagttcagaacttcgatgccagtgcataaacactcac
tcctcgcctttccatcccaaatatatcaaagaactgagagtgattgacagtggcccacat
tgtgaaaactcagaaatcattgtaaagcttgtcaatggaaaagaggtgtgcctggacccc
aaggaaaaatgggtacagaaggttgtgcagatatttttgaagagggctgagaaacaggaa
tcatga

DBGET integrated database retrieval system