KEGG   Odobenus rosmarus divergens (Pacific walrus): 101365116Help
Entry
101365116         CDS       T05148                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn] isoform X1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04146  Peroxisome
oro04213  Longevity regulating pathway - multiple species
oro05014  Amyotrophic lateral sclerosis (ALS)
oro05016  Huntington disease
oro05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:oro00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101365116 (SOD1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101365116 (SOD1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    101365116 (SOD1)
   05016 Huntington disease
    101365116 (SOD1)
   05020 Prion diseases
    101365116 (SOD1)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101365116 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 101365116
NCBI-ProteinID: XP_004406351
UniProt: A0A2U3WCX6
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MEMKAVCVLKGQGPVEGIIHFMQKEGSGPVVVSGTITGLTEGEHGFHVHQFGDNTQGCTS
AGPHFNPLSKKHGGPNDQERHVGDLGNVTAGKDGVATVSLEDSLIALSGDHSIIGRTMVV
HEKRDDLGKGGNEESTQTGNAGSRLACGVIGIAK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggagatgaaggccgtgtgcgtgctgaagggccagggcccggtggaaggcatcatccac
ttcatgcagaaggagggaagtgggcctgttgtggtgtcaggaaccattacgggattgact
gaaggtgagcatggattccacgtccatcaatttggagataatacccaaggctgtaccagt
gcaggtcctcactttaatcctctatccaaaaaacacggtgggccaaacgatcaagagagg
catgttggagacctgggcaacgtgactgctggcaaggatggtgtggccaccgtgtccttg
gaagattctctgatcgcactctcaggagaccattccatcattggccgcacaatggtggtc
cacgagaaacgagatgacttgggcaaaggtggcaatgaagaaagtacacagacgggaaac
gccgggagtcgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system