KEGG   Odobenus rosmarus divergens (Pacific walrus): 101365120
Entry
101365120         CDS       T05148                                 

Gene name
CSF2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
oro04650  Natural killer cell mediated cytotoxicity
oro04657  IL-17 signaling pathway
oro04660  T cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04668  TNF signaling pathway
oro05146  Amoebiasis
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05171  Coronavirus disease - COVID-19
oro05202  Transcriptional misregulation in cancer
oro05221  Acute myeloid leukemia
oro05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101365120 (CSF2)
   04668 TNF signaling pathway
    101365120 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101365120 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101365120 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    101365120 (CSF2)
   04660 T cell receptor signaling pathway
    101365120 (CSF2)
   04657 IL-17 signaling pathway
    101365120 (CSF2)
   04664 Fc epsilon RI signaling pathway
    101365120 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101365120 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101365120 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101365120 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101365120 (CSF2)
   05171 Coronavirus disease - COVID-19
    101365120 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101365120 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101365120 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:oro03019]
    101365120 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101365120 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:oro00536]
    101365120 (CSF2)
Messenger RNA biogenesis [BR:oro03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     101365120 (CSF2)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  CSF and other factors
   101365120 (CSF2)
Glycosaminoglycan binding proteins [BR:oro00536]
 Heparan sulfate / Heparin
  Cytokines
   101365120 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 101365120
NCBI-ProteinID: XP_004408333
UniProt: A0A2U3WHW1
LinkDB
Position
Unknown
AA seq 153 aa
MWLQNLLFLGTVVCSISAPTSSRSPVTRPSQHVDAIQEALSLLNKSRDETAMMNETVKVV
SGMFDRQEPTCLQTRLQLYKDGLQGSLSSLKQPLTLMDNHYKQHCPPTPETPCATQTITF
RSFKENLKEFLFNIPFDCWQPETTEASAARSQP
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgcttttcctgggcactgtggtctgcagcatctctgcacccacc
agctcccgcagccctgttacccgaccctctcagcacgtggatgccatccaagaggccctg
agccttctgaacaaaagtagggacgagactgctatgatgaatgaaacagtaaaagtcgtc
tctggaatgtttgaccgccaggagccgacatgcctgcagacccgcctacagctgtacaag
gacggcctgcagggcagcctcagcagcctcaagcaacccctaaccctgatggacaaccac
tataagcagcactgccctcctacgccggaaactccctgtgcaacccagactatcaccttc
agaagtttcaaagagaacctgaaggaatttctgtttaacatcccctttgactgttggcag
ccagaaacaacagaggccagtgcagccaggagccagccctga

DBGET integrated database retrieval system