KEGG   Odobenus rosmarus divergens (Pacific walrus): 101365318Help
Entry
101365318         CDS       T05148                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1 isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00250  Alanine, aspartate and glutamate metabolism
oro00410  beta-Alanine metabolism
oro00430  Taurine and hypotaurine metabolism
oro00650  Butanoate metabolism
oro01100  Metabolic pathways
oro04727  GABAergic synapse
oro04940  Type I diabetes mellitus
Module
oro_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101365318 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101365318 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101365318 (GAD1)
   00430 Taurine and hypotaurine metabolism
    101365318 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    101365318 (GAD1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    101365318 (GAD1)
Enzymes [BR:oro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101365318 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101365318
NCBI-ProteinID: XP_004407724
LinkDB All DBs
Position
Unknown
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKFFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPGDLEAKILDAKQKGLVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcgtccgcaacctcctcgaatgcgggagcggaccccaat
actaccaacctgcgccccacaacgtatgacacctggtgcggcgtggcccatggatgcacc
agaaaactggggctcaagatctgcggcttcttgcagaggaccaacagcctggaagagaag
agccggcttgtgagcgccttcaaggagaggcagtcctccaagaacctgctttcctgtgaa
aacagtgacagggatggccgtttccggcgcacagagaccgacttctccaacctgtttgct
cgagatctgcttccggcaaagaatggggaggagcaaactgtgcagttcctgctggaagtg
gtagacatactcctcaactatgtccgcaagacatttgatcgctccaccaaggtgctggac
ttccatcacccacaccagctgctggaaggcatggagggcttcaacttggagctgtcagac
caccccgagtccctggagcagatcttggttgactgcagagacaccctgaagtatggggtc
cgtacaggtcatcctcgatttttcaaccagctctctactggattggatatcattggttta
gctggagaatggctgacatcaactgccaataccaatatgtttacatatgaaattgcacct
gtatttgtcctcatggaacaaataacacttaagaagatgagagagatagttggatggtca
agtaaagacggtgatgggatattttctcctgggggagccatctccaacatgtacagcatc
atggctgctcgctacaagttcttcccagaagttaagacaaagggcatggcggccgttccc
aaactggtcctcttcacctcagaacatagtcattattccataaagaaggctggagctgca
cttggctttggaactgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
ccaggtgatttagaggcaaaaattcttgatgcgaagcaaaagggacttgttcctctctat
gtcaatgcaactgctggtacgacggtgtatggagcttttgatccaatacaggagattgca
gatatatgtgagaaatataacctatggctacatgtcgatgctgcctggggtggcgggctg
ctcatgtccaggaagcaccgccacaaactcagtggcatagaaagggccaactcagtcacc
tggaaccctcacaagatgatgggcgtgctgttgcagtgctctgccattcttgtcaaggaa
aagggtatactccaaggatgcaaccagatgtgtgccggataccttttccagccggacaag
cagtatgatgtctcctatgacactggggacaaggcaatccagtgtggccgccacgtggac
attttcaagttctggctgatgtggaaagcaaagggtacagtgggatttgaaaatcagatc
aacaaatgcttggaactggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggtttttgatggggagcctgagcatacaaatgtctgtttctggtatattccacaa
agcctcaggggcattccggatagccctgaacgacgggaaaaactacacagggtggccccc
aaaatcaaagcgctgatgatggagtctggcacgaccatggttggctaccagcctcagggg
gacaaggccaactttttccggatggtcatctcaaacccagccgctacgcagtctgatatt
gacttcctcattgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system