KEGG   Odobenus rosmarus divergens (Pacific walrus): 101365373
Entry
101365373         CDS       T05148                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1 isoform X1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro04010  MAPK signaling pathway
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04114  Oocyte meiosis
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04210  Apoptosis
oro04218  Cellular senescence
oro04270  Vascular smooth muscle contraction
oro04370  VEGF signaling pathway
oro04371  Apelin signaling pathway
oro04380  Osteoclast differentiation
oro04510  Focal adhesion
oro04540  Gap junction
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04668  TNF signaling pathway
oro04720  Long-term potentiation
oro04722  Neurotrophin signaling pathway
oro04725  Cholinergic synapse
oro04726  Serotonergic synapse
oro04730  Long-term depression
oro04810  Regulation of actin cytoskeleton
oro04910  Insulin signaling pathway
oro04912  GnRH signaling pathway
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro04916  Melanogenesis
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04921  Oxytocin signaling pathway
oro04926  Relaxin signaling pathway
oro04928  Parathyroid hormone synthesis, secretion and action
oro04929  GnRH secretion
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro05010  Alzheimer disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05034  Alcoholism
oro05132  Salmonella infection
oro05135  Yersinia infection
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05170  Human immunodeficiency virus 1 infection
oro05200  Pathways in cancer
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05216  Thyroid cancer
oro05218  Melanoma
oro05219  Bladder cancer
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101365373 (MAP2K1)
   04012 ErbB signaling pathway
    101365373 (MAP2K1)
   04014 Ras signaling pathway
    101365373 (MAP2K1)
   04015 Rap1 signaling pathway
    101365373 (MAP2K1)
   04370 VEGF signaling pathway
    101365373 (MAP2K1)
   04371 Apelin signaling pathway
    101365373 (MAP2K1)
   04668 TNF signaling pathway
    101365373 (MAP2K1)
   04066 HIF-1 signaling pathway
    101365373 (MAP2K1)
   04068 FoxO signaling pathway
    101365373 (MAP2K1)
   04072 Phospholipase D signaling pathway
    101365373 (MAP2K1)
   04071 Sphingolipid signaling pathway
    101365373 (MAP2K1)
   04024 cAMP signaling pathway
    101365373 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    101365373 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    101365373 (MAP2K1)
   04150 mTOR signaling pathway
    101365373 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101365373 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101365373 (MAP2K1)
   04210 Apoptosis
    101365373 (MAP2K1)
   04218 Cellular senescence
    101365373 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101365373 (MAP2K1)
   04540 Gap junction
    101365373 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101365373 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101365373 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101365373 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    101365373 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    101365373 (MAP2K1)
   04660 T cell receptor signaling pathway
    101365373 (MAP2K1)
   04662 B cell receptor signaling pathway
    101365373 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    101365373 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    101365373 (MAP2K1)
   04062 Chemokine signaling pathway
    101365373 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101365373 (MAP2K1)
   04929 GnRH secretion
    101365373 (MAP2K1)
   04912 GnRH signaling pathway
    101365373 (MAP2K1)
   04915 Estrogen signaling pathway
    101365373 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    101365373 (MAP2K1)
   04917 Prolactin signaling pathway
    101365373 (MAP2K1)
   04921 Oxytocin signaling pathway
    101365373 (MAP2K1)
   04926 Relaxin signaling pathway
    101365373 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    101365373 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    101365373 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    101365373 (MAP2K1)
   04916 Melanogenesis
    101365373 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101365373 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    101365373 (MAP2K1)
   04726 Serotonergic synapse
    101365373 (MAP2K1)
   04720 Long-term potentiation
    101365373 (MAP2K1)
   04730 Long-term depression
    101365373 (MAP2K1)
   04722 Neurotrophin signaling pathway
    101365373 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101365373 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101365373 (MAP2K1)
   05206 MicroRNAs in cancer
    101365373 (MAP2K1)
   05205 Proteoglycans in cancer
    101365373 (MAP2K1)
   05230 Central carbon metabolism in cancer
    101365373 (MAP2K1)
   05231 Choline metabolism in cancer
    101365373 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101365373 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101365373 (MAP2K1)
   05212 Pancreatic cancer
    101365373 (MAP2K1)
   05225 Hepatocellular carcinoma
    101365373 (MAP2K1)
   05226 Gastric cancer
    101365373 (MAP2K1)
   05214 Glioma
    101365373 (MAP2K1)
   05216 Thyroid cancer
    101365373 (MAP2K1)
   05221 Acute myeloid leukemia
    101365373 (MAP2K1)
   05220 Chronic myeloid leukemia
    101365373 (MAP2K1)
   05218 Melanoma
    101365373 (MAP2K1)
   05211 Renal cell carcinoma
    101365373 (MAP2K1)
   05219 Bladder cancer
    101365373 (MAP2K1)
   05215 Prostate cancer
    101365373 (MAP2K1)
   05213 Endometrial cancer
    101365373 (MAP2K1)
   05224 Breast cancer
    101365373 (MAP2K1)
   05223 Non-small cell lung cancer
    101365373 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101365373 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    101365373 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    101365373 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101365373 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101365373 (MAP2K1)
   05135 Yersinia infection
    101365373 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101365373 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    101365373 (MAP2K1)
   05161 Hepatitis B
    101365373 (MAP2K1)
   05160 Hepatitis C
    101365373 (MAP2K1)
   05164 Influenza A
    101365373 (MAP2K1)
   05163 Human cytomegalovirus infection
    101365373 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101365373 (MAP2K1)
   05165 Human papillomavirus infection
    101365373 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101365373 (MAP2K1)
   01522 Endocrine resistance
    101365373 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101365373 (MAP2K1)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101365373 (MAP2K1)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: STE group
  STE7 family
   101365373 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 101365373
NCBI-ProteinID: XP_004414589
UniProt: A0A2U3WY84
LinkDB
Position
Unknown
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDGEEVDFAGWLCSTIGLNQPSTPTHTAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggctcccgacggctccgcggtt
aacgggactagctcggcggagaccaacctggaggccttgcagaagaagctggaggagttg
gagctcgatgagcagcagcggaagcgccttgaggcctttctcacccagaagcagaaggtc
ggggaattgaaggatgacgacttcgagaagatcagtgagctgggtgccggcaatggtggt
gtggtgttcaaggtctcccacaagccctccggcctggtcatggccagaaagctaattcac
ctggagatcaaacctgcaatccggaaccagatcatacgggagctgcaggttctacacgag
tgcaactccccctacatcgtgggcttctatggtgcattctacagtgatggcgagatcagt
atctgcatggagcacatggatgggggttccttggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggtctgacatacctg
agggagaagcacaagataatgcacagagatgtcaagccttccaacatcctcgtgaactcc
cgtggggagatcaagctctgtgactttggggtcagtgggcagctcattgactccatggcc
aactccttcgtgggcacacggtcctacatgtcgccagaaagactccaggggactcattac
tcggtgcagtcggacatctggagcatggggctctctctggttgagatggcggttgggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttgggtgccaagtggag
ggagatgcggctgagacgccacccagaccaaggacccctggaaggcccctcagctcttat
ggaatggacagccgacctcccatggcaatttttgagttgttggattacatagtcaacgag
cctcctccaaaactgcccagtggagtattcagtctggaatttcaagattttgtgaataag
tgcttaataaaaaacccagcagagagagcagatctgaagcaactcatggttcatgccttt
atcaagagatcggacggagaggaagtggattttgcaggttggctctgctccaccattggc
cttaaccagcccagcacaccgacccacacagccggtgtctaa

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101376586
Entry
101376586         CDS       T05148                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01522  Endocrine resistance
oro04010  MAPK signaling pathway
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04210  Apoptosis
oro04218  Cellular senescence
oro04270  Vascular smooth muscle contraction
oro04370  VEGF signaling pathway
oro04371  Apelin signaling pathway
oro04540  Gap junction
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04613  Neutrophil extracellular trap formation
oro04620  Toll-like receptor signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04720  Long-term potentiation
oro04722  Neurotrophin signaling pathway
oro04730  Long-term depression
oro04810  Regulation of actin cytoskeleton
oro04910  Insulin signaling pathway
oro04912  GnRH signaling pathway
oro04915  Estrogen signaling pathway
oro04916  Melanogenesis
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04921  Oxytocin signaling pathway
oro04926  Relaxin signaling pathway
oro04929  GnRH secretion
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro05010  Alzheimer disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05132  Salmonella infection
oro05135  Yersinia infection
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05170  Human immunodeficiency virus 1 infection
oro05200  Pathways in cancer
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05216  Thyroid cancer
oro05218  Melanoma
oro05219  Bladder cancer
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05230  Central carbon metabolism in cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101376586 (MAP2K2)
   04012 ErbB signaling pathway
    101376586 (MAP2K2)
   04014 Ras signaling pathway
    101376586 (MAP2K2)
   04015 Rap1 signaling pathway
    101376586 (MAP2K2)
   04370 VEGF signaling pathway
    101376586 (MAP2K2)
   04371 Apelin signaling pathway
    101376586 (MAP2K2)
   04066 HIF-1 signaling pathway
    101376586 (MAP2K2)
   04068 FoxO signaling pathway
    101376586 (MAP2K2)
   04072 Phospholipase D signaling pathway
    101376586 (MAP2K2)
   04071 Sphingolipid signaling pathway
    101376586 (MAP2K2)
   04024 cAMP signaling pathway
    101376586 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    101376586 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    101376586 (MAP2K2)
   04150 mTOR signaling pathway
    101376586 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101376586 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    101376586 (MAP2K2)
   04218 Cellular senescence
    101376586 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101376586 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101376586 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101376586 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101376586 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    101376586 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    101376586 (MAP2K2)
   04660 T cell receptor signaling pathway
    101376586 (MAP2K2)
   04662 B cell receptor signaling pathway
    101376586 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    101376586 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101376586 (MAP2K2)
   04929 GnRH secretion
    101376586 (MAP2K2)
   04912 GnRH signaling pathway
    101376586 (MAP2K2)
   04915 Estrogen signaling pathway
    101376586 (MAP2K2)
   04917 Prolactin signaling pathway
    101376586 (MAP2K2)
   04921 Oxytocin signaling pathway
    101376586 (MAP2K2)
   04926 Relaxin signaling pathway
    101376586 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    101376586 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    101376586 (MAP2K2)
   04916 Melanogenesis
    101376586 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101376586 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    101376586 (MAP2K2)
   04730 Long-term depression
    101376586 (MAP2K2)
   04722 Neurotrophin signaling pathway
    101376586 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101376586 (MAP2K2)
   05206 MicroRNAs in cancer
    101376586 (MAP2K2)
   05205 Proteoglycans in cancer
    101376586 (MAP2K2)
   05230 Central carbon metabolism in cancer
    101376586 (MAP2K2)
   05231 Choline metabolism in cancer
    101376586 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101376586 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101376586 (MAP2K2)
   05225 Hepatocellular carcinoma
    101376586 (MAP2K2)
   05226 Gastric cancer
    101376586 (MAP2K2)
   05214 Glioma
    101376586 (MAP2K2)
   05216 Thyroid cancer
    101376586 (MAP2K2)
   05221 Acute myeloid leukemia
    101376586 (MAP2K2)
   05220 Chronic myeloid leukemia
    101376586 (MAP2K2)
   05218 Melanoma
    101376586 (MAP2K2)
   05211 Renal cell carcinoma
    101376586 (MAP2K2)
   05219 Bladder cancer
    101376586 (MAP2K2)
   05215 Prostate cancer
    101376586 (MAP2K2)
   05213 Endometrial cancer
    101376586 (MAP2K2)
   05224 Breast cancer
    101376586 (MAP2K2)
   05223 Non-small cell lung cancer
    101376586 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101376586 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    101376586 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101376586 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101376586 (MAP2K2)
   05135 Yersinia infection
    101376586 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101376586 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    101376586 (MAP2K2)
   05161 Hepatitis B
    101376586 (MAP2K2)
   05160 Hepatitis C
    101376586 (MAP2K2)
   05164 Influenza A
    101376586 (MAP2K2)
   05163 Human cytomegalovirus infection
    101376586 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101376586 (MAP2K2)
   05165 Human papillomavirus infection
    101376586 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101376586 (MAP2K2)
   01522 Endocrine resistance
    101376586 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101376586 (MAP2K2)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101376586 (MAP2K2)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: STE group
  STE7 family
   101376586 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 101376586
NCBI-ProteinID: XP_004395390
UniProt: A0A2U3VKE8
LinkDB
Position
Unknown
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLAELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPVVDGVEGEPHSISPRPRP
PGRPISGHGTDSRPAMAIFELLDYIVNEPPPKLPSGVFTQDFQEFVNKCLIKNPAERADL
KMLMSHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcactatcaaccccgccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaagcaaacttggtggacctccagaagaag
ctagcggagctagaactcgacgagcagcagaagaagcgactggaagccttcctcacccag
aaggccaaggttggggaactcaaggacgatgacttcgaacgaatctcggagctgggagcc
gggaacggtggggtggtcaccaaggtccagcacagaccttctggcctcatcatggcgaga
aagctaatccacctggaaatcaagccggccatccggaaccagatcatccgtgagctgcag
gtgctgcacgagtgtaactctccgtacatcgtgggcttctacggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggatggcggctctctggatcaggtgttgaaa
gaagccaagagaattcctgaggagatcttggggaaggtcagcattgcggttctccgggga
ttggcgtatctccgggaaaagcaccagatcatgcaccgagacgtgaaaccttccaacatc
ctcgtcaactcccgaggggagattaagctgtgcgattttggggtgagcggacagctcatc
gactccatggccaactccttcgtgggaactcggtcctacatgtctccagagcggctgcag
ggcacgcactactcggtgcagtcggacatctggagcatgggcctgtccctggtggagctg
tccatcggaaggtaccccatccccccgccagacgccaaggagctagaggccatatttggc
cggcccgtggtggacggggtagaaggagagcctcacagcatctcgccacggccgagaccc
cctggacgccccatcagcggtcacgggacggacagccggccggccatggccatctttgag
ctgctggactatattgtgaacgagccacctcctaagctgcccagcggtgtcttcacccag
gacttccaggagtttgtaaataaatgcctaataaagaacccagcagagcgagcggatctg
aagatgctcatgagccacaccttcatcaagcggtccgaggtggaagaagtggattttgcc
ggctggttgtgtaaaacgctgcggctgaaccagcccagcacacccacgcgcactgccgtg
tga

DBGET integrated database retrieval system