KEGG   Odobenus rosmarus divergens (Pacific walrus): 101365427
Entry
101365427         CDS       T05148                                 

Gene name
CSF1
Definition
(RefSeq) macrophage colony-stimulating factor 1 isoform X1
  KO
K05453  macrophage colony-stimulating factor 1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04060  Cytokine-cytokine receptor interaction
oro04061  Viral protein interaction with cytokine and cytokine receptor
oro04151  PI3K-Akt signaling pathway
oro04380  Osteoclast differentiation
oro04640  Hematopoietic cell lineage
oro04668  TNF signaling pathway
oro05010  Alzheimer disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101365427 (CSF1)
   04014 Ras signaling pathway
    101365427 (CSF1)
   04015 Rap1 signaling pathway
    101365427 (CSF1)
   04668 TNF signaling pathway
    101365427 (CSF1)
   04151 PI3K-Akt signaling pathway
    101365427 (CSF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101365427 (CSF1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101365427 (CSF1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101365427 (CSF1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101365427 (CSF1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    101365427 (CSF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101365427 (CSF1)
   05022 Pathways of neurodegeneration - multiple diseases
    101365427 (CSF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101365427 (CSF1)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  CSF and other factors
   101365427 (CSF1)
SSDB
Motif
Pfam: CSF-1 CcmH
Other DBs
NCBI-GeneID: 101365427
NCBI-ProteinID: XP_004407228
UniProt: A0A2U3WF20
LinkDB
Position
Unknown
AA seq 553 aa
MTSRGAAGRCPPTTWLQALLLLVWLLASRSITGEVSEHCSHMIGNGHLQFLQQLIDSQME
TSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVKLQELSLRLK
SCFTKDYEEQDKACVRTFYETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNNSFAKCSS
QDVVTKPDCNCLYPKATPSSDLASVSPQQPPAPSMAPMAGLTWADSEGTEGSSLLPSEQP
PRPVDLDPGSAKQRSPRSTCPSFESLEPPGVEAGPSGDSRQPRPSVGGPVPGMEDILDSA
LGTNWTLEEASGEASEGPVPQGAELGGGRVQAETTARPSGRLSAPSPLPYAARGQQPDDT
PGTPLPTVDPARPAGQAQSHTLEKTDRPSALSRDHQEPSLARTPPRPPRGLSSPSALSAQ
PKLPRRHSWGYVLPLGELEGRRSTRDRRSLTELEGRGASEGAAGVPAPFNSVPLTDTGHE
RQQEGPPDPQLPGFTFHLLVPGIILVLLAVGGLLFYRRRRRSRREPQTVDSPTEQPESSP
LTQDEDREVELPV
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgacctcgcggggcgccgccgggcgctgccctcccacgacatggctgcaggccctgcta
ctgctggtctggctcctggcgagcaggagtattaccggggaggtgtcagaacactgtagc
cacatgatcgggaacggacacctgcagttcctccagcagctgatcgatagtcagatggag
acttcctgccagattgcttttgagtttgtagaccaggagcagttgaaagatcccgtgtgc
taccttaagaaggcatttctcctggtgcaagacataatggaggacaccatgcgcttcaaa
gacaatactcccaacgccaatgtcatcgtgaagctccaggaactgtctctgaggcttaag
agctgcttcaccaaggactatgaagagcaggacaaggcctgtgtccgaactttctatgag
acacccctgcagttgctggaaaagatcaagaatgtctttaatgaaacaaagaatctcctg
aaaaaggactggaacgttttcagcaagaactgcaacaacagcttcgctaagtgctccagc
caagatgtggtgaccaagcctgattgcaactgcctgtaccccaaagccacccctagcagt
gacctggcctctgtctcccctcagcagccccctgccccctccatggcccctatggccggc
ttgacctgggctgactctgaggggacagagggcagctccctcttgcccagtgagcagcct
ccccgcccagtggacctggacccgggaagtgccaagcagcgatcacccaggagcacctgc
ccgagctttgaatctctggagccgccaggtgtggaggccggccccagcggagattcacgt
cagccccggccctctgtcgggggtcccgtccctgggatggaggacattcttgactctgcg
ttgggcaccaactggaccctggaagaggcctctggagaggctagtgagggtcccgtaccc
caaggggcagagctgggaggaggcagagtccaggccgagacgactgccaggcccagtggc
cgcctgtcagcaccttctccactgccctacgcagccagaggccagcagccggacgacacg
cctggcacacccctgcccacggtggaccctgcacgacccgctggccaggcccagagtcac
acccttgagaagacagaccgtccatctgccctgtccagagaccaccaggagccgagcttg
gccaggaccccgccgcggcccccacgaggcctcagcagtccctcggccctctctgcacag
ccaaagcttcccagaaggcactcctggggctatgtgctgcccctcggggagttggagggc
agaaggagcaccagggatcgaaggagcctcacagagctggaaggaagaggagcaagtgag
ggggcggccggggtcccggccccttttaactccgttcctttgactgacacaggccatgag
aggcagcaggagggaccccctgaccctcagctccccgggtttaccttccacctgctggtg
cccggcatcatcctggtcctgctggccgtcggaggtctcctgttctacaggcggagacgg
cggagccgtcgagagcctcagacagtggattctcccacggagcaaccagagagcagcccc
ctgacccaggatgaggacagagaggtggaactgccagtgtag

DBGET integrated database retrieval system