KEGG   Odobenus rosmarus divergens (Pacific walrus): 101365624
Entry
101365624         CDS       T05148                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04020  Calcium signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04260  Cardiac muscle contraction
oro04261  Adrenergic signaling in cardiomyocytes
oro04270  Vascular smooth muscle contraction
oro04713  Circadian entrainment
oro04720  Long-term potentiation
oro04723  Retrograde endocannabinoid signaling
oro04724  Glutamatergic synapse
oro04725  Cholinergic synapse
oro04726  Serotonergic synapse
oro04727  GABAergic synapse
oro04728  Dopaminergic synapse
oro04742  Taste transduction
oro04911  Insulin secretion
oro04912  GnRH signaling pathway
oro04921  Oxytocin signaling pathway
oro04924  Renin secretion
oro04925  Aldosterone synthesis and secretion
oro04927  Cortisol synthesis and secretion
oro04929  GnRH secretion
oro04930  Type II diabetes mellitus
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro05010  Alzheimer disease
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05031  Amphetamine addiction
oro05410  Hypertrophic cardiomyopathy
oro05412  Arrhythmogenic right ventricular cardiomyopathy
oro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101365624 (CACNA1C)
   04020 Calcium signaling pathway
    101365624 (CACNA1C)
   04024 cAMP signaling pathway
    101365624 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    101365624 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101365624 (CACNA1C)
   04929 GnRH secretion
    101365624 (CACNA1C)
   04912 GnRH signaling pathway
    101365624 (CACNA1C)
   04921 Oxytocin signaling pathway
    101365624 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    101365624 (CACNA1C)
   04924 Renin secretion
    101365624 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    101365624 (CACNA1C)
   04927 Cortisol synthesis and secretion
    101365624 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101365624 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    101365624 (CACNA1C)
   04270 Vascular smooth muscle contraction
    101365624 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    101365624 (CACNA1C)
   04727 GABAergic synapse
    101365624 (CACNA1C)
   04725 Cholinergic synapse
    101365624 (CACNA1C)
   04728 Dopaminergic synapse
    101365624 (CACNA1C)
   04726 Serotonergic synapse
    101365624 (CACNA1C)
   04720 Long-term potentiation
    101365624 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    101365624 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    101365624 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101365624 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101365624 (CACNA1C)
   05020 Prion disease
    101365624 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    101365624 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    101365624 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101365624 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101365624 (CACNA1C)
   05414 Dilated cardiomyopathy
    101365624 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101365624 (CACNA1C)
   04934 Cushing syndrome
    101365624 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oro04040]
    101365624 (CACNA1C)
Ion channels [BR:oro04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101365624 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 101365624
NCBI-ProteinID: XP_004406936
UniProt: A0A2U3WEB7
LinkDB
Position
Unknown
AA seq 2190 aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKYPLPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLK
VIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKT
CYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVF
QCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKA
RGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTE
NVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLN
TLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVC
GGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLL
LFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIM
AYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKK
LARTASPEKKQEVVEKPAVEETKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSPY
PNPENTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIV
NDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKILGNAD
YVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKIL
RVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYT
CSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGW
PELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEY
KNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLA
MQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIID
VILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFR
LFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALND
TTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGS
SFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAK
GRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTA
LRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFR
KFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSA
ASEDDIFRRAGGLFGNHVGCYQSDGRSAFPQTFTTQRPLHINKAANSQGDTGSPSHEKLV
DSTFTPSSYSSTGSNANINNANNTALGRFPRPAGYPSSVSTVEGRGPPLSPAVRVQEAAW
KLSSKRCHSRESQIAMVCQEVSQDEPYDVRMSEDTEYCSEPSLISTEMLSYQDDENRQLT
PPEEDKRGIQQSPKRGFLRSASLGRRASFHLECLKRQKNQGGDVSQKTVLPLHLVHHQAL
AVAGLSPLLQRSHSPSTFPRPCATPPATPGSRGWPPQPIPTLRLERAESSEKLNSSFPSI
HCSSWSGEPTPCAGGSSAIRRARPVSLTVPSQAGARGRQFHGSASSLVEAVLISEGLGQF
AQDPKFIEVTTQELADACDMTIEEMENAADNILSGGAQQSPNGTLLPFVNCRDPGQDRVG
GQEGESCAAARACRRSEEEHQDSRAHAGSL
NT seq 6573 nt   +upstreamnt  +downstreamnt
atggtcaatgagaacacgaggatgtacattccagaggaaaaccatcaaggttccaactat
gggagcccgcgccctgctcatgccaacatgaatgccaatgctgctgcagggctcgcccct
gagcacatccctacaccgggggcggccttgtcctggcaggcggccatcgacgcggcccgg
caggccaagctgatggggagcgccggcaacgcgaccatctccacggtcagctccacacag
cggaagcggcagcagtacgggaaacccaagaagcagggcagcacgacggccacgcgcccg
ccccgtgccctgctctgcctgactctgaagaaccccatccggagggcatgcatcagcatc
gtcgaatggaaatatcctttaccatttgaaataattattttactgactatttttgccaat
tgtgtggccttagcgatctatattccctttccagaagatgactccaacgccaccaattcc
aacctggaacgagtggaatatctctttctcataatttttactgtggaagcatttttaaaa
gtaatagcctatggacttctctttcaccccaacgcttacctccgcaatggttggaattta
ctagattttataattgtggttgtagggctttttagtgcaattttagaacaagcaaccaaa
gccgacggggcaaatgctctgggagggaaaggagctggatttgacgtgaaggcactgagg
gcattccgtgtgctgcgtcccttgcgcctggtgtctggagtcccaagtctccaggtggtt
ctgaattccattatcaaggccatggtgcccctgctgcatattgccctgctagtgctgttt
gtcatcatcatctatgctatcatcggcctggagctcttcatggggaagatgcataagacc
tgctacaaccaggagggcatagcagatgtaccagcagaagatgatccttccccttgtgct
ctggagacaggccatgggcggcagtgtcagaacggcactgtgtgcaagcccgggtgggac
gggcccaagcacggcatcaccaacttcgacaattttgccttcgccatgttgacggtgttc
cagtgcatcaccatggagggctggacagacgtgctgtactgggtcaatgatgccgtagga
agggactggccctggatctattttgttacactaatcatcatagggtcattttttgtactt
aacttggttctcggtgttcttagcggagagttttccaaagaaagggagaaggccaaggct
cggggagatttccagaagcttcgagagaagcagcagctggaagaggacctgaagggctac
ctggactggatcacccaggcagaggacatcgaccccgagaatgaggatgaaggcatggat
gaggagaagccccgaaacatgagcatgcccacaagcgagaccgagtctgtcaacaccgaa
aacgtggctggaggtgacatcgagggagagaactgcggggccaggctggcccaccggatt
tccaaatcaaagttcagccgctactggcgccggtggaaccggttctgcagaagaaagtgt
cgtgctgcagtcaagtctaatgtcttctactggcttgtgatcttcctggtgttcctcaac
acgctcaccatcgcctcggaacactacaaccagccccactggctcacagaggtgcaagac
acggccaacaaggcactgctggcccttttcaccgcagagatgctgctgaaaatgtacagc
ctaggcctgcaggcctactttgtgtccctcttcaaccgcttcgactgcttcatcgtgtgc
gggggcatcctggagaccatcctggtggagaccaagatcatgtctcccttgggcatctct
gtgctgagatgtgtccggctgctgcggatatttaaaatcacaaggtactggaattcctta
agcaatctggtggcatccttgctgaattctgtacgctccattgcctccctgctgctgctc
ctcttcctcttcatcatcatcttctccctcctggggatgcagctctttgggggaaagttc
aactttgatgaaatgcagacccggagaagcacatttgataactttccccagtccctcctc
actgtgtttcagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatg
gcttatggcggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttc
atctgtggaaactatatcctactgaatgtgttcttggccattgctgtggacaacctggct
gatgctgagagcctcacatctgcccaaaaggaggaggaagaagagaaggagagaaagaag
ctggccaggactgccagcccagagaagaaacaagaggtggtggagaagccagcagtggag
gagaccaaggaggagaaaattgaactgaaatccattacagctgatggagagtccccaccc
accaccaagatcaacatggatgacctccagcccaatgaaaatgaggataagagtccctac
ccaaacccagaaaatacaggagaagaggatgaggaggagcctgagatgcctgtgggcccc
cgcccacgaccactctctgagctgcaccttaaggaaaaggcagtgcccatgccagaagcc
agtgcgtttttcatcttcagccccaacaacagatttcgcctccagtgtcaccgcatcgtc
aatgacacgatcttcaccaacctgatcctcttcttcattctgctcagcagcatttccctg
gcagctgaggaccccgtccagcacacctccttcaggaaccatattctgttttattttgac
attgttttcactaccattttcaccattgaaattgctctgaagatcctaggcaatgcagac
tatgtcttcactagtatctttacattagaaattatccttaagatgactgcttatggggct
ttcctacacaagggctctttttgccgaaactacttcaacatcttggacctgctggtggtc
agcgtgtccctcatttcctttggcatccagtccagcgcaatcaacgtggtgaagatctta
cgagtcctgcgtgtcctcaggcccctgagagccatcaacagggccaaggggctaaagcac
gtggttcagtgcgtgtttgttgccatccggaccatcgggaacatcgtgattgtcaccacg
ctgcttcagttcatgttcgcctgcatcggggtccagcttttcaagggaaagctctacacc
tgctcagatagttccaaacagactgaggcggaatgcaagggtaactacatcacatacaag
gacggggaggtcgaccaccccatcatccaaccccgcagctgggagaacagcaagtttgac
tttgacaatgttctggcggccatgatggccctctttaccgtctctacctttgaggggtgg
ccggagctgctgtaccgctccatcgactcccacacagaagacaagggccccatctacaac
taccgtgtggagatctccatctttttcatcatctacatcatcatcattgccttcttcatg
atgaacatcttcgtgggtttcgtcatcgtcaccttccaggagcagggggagcaggaatac
aagaactgtgagctggacaagaaccagcgacagtgcgtggaatatgccctcaaggcccgg
cccctgcgcaggtacattcccaagaaccagcaccagtacaaagtgtggtacgtggtcaac
tccacctactttgaatacctgatgttcgtcctcatcctgctcaacaccatctgcttggcc
atgcagcactacggccagagctgcctcttcaaaattgccatgaacatcctcaacatgctc
ttcactggcctcttcaccgtggagatgattctgaagctcattgccttcaaacccaagggt
tactttagtgatccctggaatgtttttgacttcctcatcgtaattggcagcataattgac
gtcattctcagtgagactaatcactatttctgtgatgcatggaatacatttgacgccttg
attgttgtgggtagcattgttgatatagcaatcaccgaggtaaacccagctgaacatacc
caatgctctccctttatgaacgcagaggagaactcccgcatctccatcaccttcttccgc
ctcttccgggtcatgcgcctggtcaagctgctgagccgcggggagggcattcggaccctg
ctgtggaccttcatcaagtccttccaggccctgccctacgtggctcttctgatagtgatg
ctgttcttcatctacgcggtgatcgggatgcaggtgtttgggaaaattgccctgaatgac
accacagagatcaaccggaacaacaacttccagaccttcccccaagctgtgctgcttctc
ttcaggtgtgccacaggggaggcatggcaggatatcatgctggcctgcatgccagggaag
aagtgtgcccccgagtcggagcccagcaacagcacagaaggcgaaacgccctgtggtagc
agctttgcggtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaac
ctctttgtagccgtcatcatggacaactttgactacctgacaagggattggtcaatcctt
ggtccccatcatctggatgaatttaaaagaatctgggcagagtatgatcctgaagccaag
ggtcgtatcaaacacctagatgtggtgaccctgctccgacggattcagcccccactgggt
tttgggaagttgtgccctcaccgtgtggcttgcaaacgcctggtctccatgaacatgcct
ctgaacagtgatgggacagtcatgttcaatgccaccctgtttgccctggtccggacagcc
ctgagaattaaaacagaaggaaacctagaacaagccaatgaggagctgcgggccataatc
aagaagatctggaagcggaccagcatgaagctgctggaccaagtggtgcccccagcgggt
gatgacgaggtcacggttggcaagttttatgctactttcctgatccaggaatacttccgg
aaattcaagaagcgcaaagagcagggcctggtgggcaaaccctcccagaggaacgcccta
tccctgcaggctggcttgcgcacactgcatgacatcgggcctgagatccgacgggcgatc
tctggagatctgacggccgaggaggagctggacaaggccatgaaggaggctgtgtctgct
gcctccgaagacgacatcttcaggagggccggcggcctgttcggcaaccacgttggctgc
taccaaagcgacggccggagcgccttcccccagaccttcaccacccagcgcccactgcac
atcaacaaggcggctaacagccaaggcgacaccgggtcgccgtcccacgagaaactggtg
gactccactttcacccccagcagctactcgtccactggctccaacgccaacatcaacaat
gccaacaacactgccctgggccgcttcccccgccccgctggctaccccagctcggtcagc
accgtggagggccgtgggccccccttgtctcctgccgtccgggtacaggaggcagcctgg
aagctcagctccaagaggtgccactcccgggagagccagatagccatggtgtgtcaggag
gtctctcaggacgagccctatgacgtgcggatgagcgaagacaccgagtactgcagcgag
cccagcctgatctccacagagatgctctcctatcaggacgatgaaaatcggcaattaaca
ccacctgaggaggacaagagaggcatccagcaatctccaaagaggggtttcctccgctct
gcctcactaggtcgaagggcctccttccacctggaatgtctgaagcgacagaagaatcaa
gggggagacgtctctcagaagacagtcctgcccttgcatctggttcatcatcaggcattg
gcagtggcgggcctgagccccctcctgcagagaagccattcccccagcacgttccccagg
ccgtgcgccacccccccagccacaccgggcagccgaggctggcccccacagccgatcccc
accctgcggctggagagggccgagtccagcgagaaactcaacagcagcttcccatccatc
cactgcagctcctggtccggggagcccacgccctgcgctgggggcagcagcgccatccgg
agagcccggccggtgtccctcactgtgcccagccaggctggggcccggggcaggcagttc
cacggcagtgccagcagcctggtggaagcggtcttgatttcagaaggactggggcagttt
gctcaagatcccaagtttatcgaggtcacaacccaggagctggctgatgcctgtgacatg
accatagaggagatggagaacgccgccgacaacatcctcagtgggggcgcccagcagagc
cccaacggcaccctactaccttttgttaactgcagggacccggggcaggacagagtgggg
ggccaagagggcgagagctgcgccgcggctcgggcgtgtcggaggagcgaggaggagcac
caggacagcagagcccacgccggcagcctgtag

DBGET integrated database retrieval system