KEGG   Odobenus rosmarus divergens (Pacific walrus): 101365718
Entry
101365718         CDS       T05148                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro04012  ErbB signaling pathway
oro04062  Chemokine signaling pathway
oro04110  Cell cycle
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04310  Wnt signaling pathway
oro04340  Hedgehog signaling pathway
oro04360  Axon guidance
oro04390  Hippo signaling pathway
oro04510  Focal adhesion
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04657  IL-17 signaling pathway
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04722  Neurotrophin signaling pathway
oro04728  Dopaminergic synapse
oro04910  Insulin signaling pathway
oro04916  Melanogenesis
oro04917  Prolactin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro05010  Alzheimer disease
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05135  Yersinia infection
oro05160  Hepatitis C
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05200  Pathways in cancer
oro05210  Colorectal cancer
oro05213  Endometrial cancer
oro05215  Prostate cancer
oro05217  Basal cell carcinoma
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101365718 (GSK3B)
   04310 Wnt signaling pathway
    101365718 (GSK3B)
   04340 Hedgehog signaling pathway
    101365718 (GSK3B)
   04390 Hippo signaling pathway
    101365718 (GSK3B)
   04151 PI3K-Akt signaling pathway
    101365718 (GSK3B)
   04150 mTOR signaling pathway
    101365718 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101365718 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101365718 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    101365718 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101365718 (GSK3B)
   04657 IL-17 signaling pathway
    101365718 (GSK3B)
   04662 B cell receptor signaling pathway
    101365718 (GSK3B)
   04062 Chemokine signaling pathway
    101365718 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101365718 (GSK3B)
   04917 Prolactin signaling pathway
    101365718 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    101365718 (GSK3B)
   04919 Thyroid hormone signaling pathway
    101365718 (GSK3B)
   04916 Melanogenesis
    101365718 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    101365718 (GSK3B)
   04722 Neurotrophin signaling pathway
    101365718 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    101365718 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101365718 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101365718 (GSK3B)
   05225 Hepatocellular carcinoma
    101365718 (GSK3B)
   05226 Gastric cancer
    101365718 (GSK3B)
   05217 Basal cell carcinoma
    101365718 (GSK3B)
   05215 Prostate cancer
    101365718 (GSK3B)
   05213 Endometrial cancer
    101365718 (GSK3B)
   05224 Breast cancer
    101365718 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101365718 (GSK3B)
   05020 Prion disease
    101365718 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    101365718 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101365718 (GSK3B)
   04931 Insulin resistance
    101365718 (GSK3B)
   04934 Cushing syndrome
    101365718 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101365718 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101365718 (GSK3B)
   05162 Measles
    101365718 (GSK3B)
   05163 Human cytomegalovirus infection
    101365718 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101365718 (GSK3B)
   05165 Human papillomavirus infection
    101365718 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101365718 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101365718 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oro03036]
    101365718 (GSK3B)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     101365718 (GSK3B)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   101365718 (GSK3B)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101365718 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 101365718
NCBI-ProteinID: XP_004403576
UniProt: A0A2U3W616
LinkDB
Position
Unknown
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRETPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANAGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgactacagtg
gtggcaactcctgggcagggtccagataggccacaagaagtcagctatacagacactaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggttgccatcaagaaggtattgcaggacaagagatttaagaaccgagagctccaaatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gagaagaaagatgaagtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgcttcctgtgatctatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatatgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgcaggctgtgtgttggctgagctgttgctaggacaaccaatatttccaggggac
agtggtgtggatcaattggtggaaataatcaaggtcctggggacaccaacaagggagcaa
attagagaaatgaacccaaactacacagaattcaaattccctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccgaccc
cggactccaccggaagcaattgcactgtgtagccgtctgctggagtatacaccaactgcc
cgattgacaccactggaagcttgtgcacattcattttttgatgaattaagggacccaaat
gtcaaattaccaaatgggcgagaaacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctagctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaacccctacaaatgccacagcagcctcagatgctaatgccggagaccgtggacag
accaacaacgccgcttctgcatcagcttccaactccacctga

DBGET integrated database retrieval system