KEGG   Odobenus rosmarus divergens (Pacific walrus): 101365728
Entry
101365728         CDS       T05148                                 

Gene name
IL13
Definition
(RefSeq) interleukin-13
  KO
K05435  interleukin 13
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04630  JAK-STAT signaling pathway
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04664  Fc epsilon RI signaling pathway
oro05200  Pathways in cancer
oro05310  Asthma
oro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101365728 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101365728 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101365728 (IL13)
   04657 IL-17 signaling pathway
    101365728 (IL13)
   04664 Fc epsilon RI signaling pathway
    101365728 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101365728 (IL13)
  09163 Immune disease
   05310 Asthma
    101365728 (IL13)
   05321 Inflammatory bowel disease
    101365728 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101365728 (IL13)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Interleukins
   101365728 (IL13)
SSDB
Motif
Pfam: IL13 DUF3136 Guanylate_cyc
Other DBs
NCBI-GeneID: 101365728
NCBI-ProteinID: XP_004408334
UniProt: A0A2U3WHT8
LinkDB
Position
Unknown
AA seq 131 aa
MALWLTMVIALTCLGGLASPVPGPNSTALKELIEELANITQNQASLCNGSMVWSIKWTGS
MYCAALESLVNVSDCSAIQRTQRMLKALCLHNTLAGQISSERSQDTKIEVIQLMKNLLTH
VRGVYRHGKLT
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcactctggttgactatggtcattgctctcacctgccttggcggccttgcctccccg
gtccctgggcctaactccacagccctcaaggagctcattgaggaactggccaacatcacc
cagaatcaggcatccctctgcaatggcagcatggtgtggagcatcaagtggaccggcagc
atgtactgtgcagctctagaatctttggtcaatgtctccgactgcagcgccatccaaagg
acacagaggatgctgaaagcgctgtgccttcacaacaccttggccgggcagatctccagt
gagcgcagccaagacacaaaaattgaagtgatccagttgatgaaaaacctgctcacccac
gtccggggagtttatcgccacgggaagttaacatga

DBGET integrated database retrieval system